Protein Info for Rru_A3741 in Rhodospirillum rubrum S1H

Annotation: 3-dehydroquinate synthase (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 385 transmembrane" amino acids 116 to 136 (21 residues), see Phobius details TIGR01357: 3-dehydroquinate synthase" amino acids 29 to 371 (343 residues), 369.7 bits, see alignment E=7.5e-115 PF13685: Fe-ADH_2" amino acids 33 to 148 (116 residues), 34.4 bits, see alignment E=3.4e-12 PF01761: DHQ_synthase" amino acids 84 to 195 (112 residues), 160.2 bits, see alignment E=2.1e-51 PF24621: DHQS_C" amino acids 198 to 348 (151 residues), 154.7 bits, see alignment E=2.4e-49

Best Hits

Swiss-Prot: 100% identical to AROB_RHORT: 3-dehydroquinate synthase (aroB) from Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1)

KEGG orthology group: K01735, 3-dehydroquinate synthase [EC: 4.2.3.4] (inferred from 100% identity to rru:Rru_A3741)

MetaCyc: 51% identical to 3-dehydroquinate synthase (Escherichia coli K-12 substr. MG1655)
3-dehydroquinate synthase. [EC: 4.2.3.4]

Predicted SEED Role

"3-dehydroquinate synthase (EC 4.2.3.4)" in subsystem Chorismate Synthesis or Common Pathway For Synthesis of Aromatic Compounds (DAHP synthase to chorismate) or Type IV pilus (EC 4.2.3.4)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.2.3.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RMW0 at UniProt or InterPro

Protein Sequence (385 amino acids)

>Rru_A3741 3-dehydroquinate synthase (NCBI) (Rhodospirillum rubrum S1H)
MSPDTAADAAADPALQSSVLTVSLGERSYPIHIGPGLLGRAGALIAPLLRKPRVFVVTDA
TVAALHLDPLLASLGAAGIAHDHVVLPAGEATKSFSQLEELLDLLLAARFERSTTLLALG
GGVIGDLVGFAAAILLRGVDFIQIPTTLLAQVDSSVGGKTGINTAYGKNLVGAFHQPRLV
LADTTVLDTLPRRELLAGYGEVVKYGVIDDPAFFDWLEEHGSALIAGDGGARIHAVLTAC
RAKARVVAEDEREGGRRALLNLGHTFGHALEAETGFGPTLLHGEAVALGMVMALDLSVRL
GLCPPADAARLRAHLDHVGLPTDPRRLEGAPAWNAERLLAAMDHDKKVEDGKVTFVLARG
IGRSLLWREADTASVLATLRAAVAP