Protein Info for Rru_A3711 in Rhodospirillum rubrum S1H

Annotation: Thioredoxin-related (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 312 PF00085: Thioredoxin" amino acids 36 to 130 (95 residues), 52.6 bits, see alignment E=1e-17 PF13098: Thioredoxin_2" amino acids 46 to 131 (86 residues), 27.6 bits, see alignment E=7.9e-10 PF14559: TPR_19" amino acids 150 to 215 (66 residues), 44.6 bits, see alignment E=3.7e-15 PF14561: TPR_20" amino acids 222 to 311 (90 residues), 108.4 bits, see alignment E=4.5e-35

Best Hits

KEGG orthology group: K05838, putative thioredoxin (inferred from 100% identity to rru:Rru_A3711)

Predicted SEED Role

"FIG000875: Thioredoxin domain-containing protein EC-YbbN"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RMZ0 at UniProt or InterPro

Protein Sequence (312 amino acids)

>Rru_A3711 Thioredoxin-related (NCBI) (Rhodospirillum rubrum S1H)
MSLIFDGSGTPIKATTAPKSGSGSGALVKDSDTPRFAADVIEASREVPVIVDFWSPSSPA
CATLTALLERLVTQRAGAVRLVKINIDSNRELAAQLRLQSVPTIYAFADGRPVDGFMGAL
PEAEVKAFIDRLTGNAGDVIDEALAQADALRDQGDIDSAFDIYQQVLEQDQANPRAMAGA
LRCRLAQGANDEVREVLNRLPPALAGHAEIIALKSVLDLAEQAEKAGPTAELRARIAADP
ADHQASIDLAVALFAAGDTEAAMDLLLESIRRDRAWNEEAARKQLLKFWEALGHTHPLTV
GGRRKLSSILFS