Protein Info for Rru_A3684 in Rhodospirillum rubrum S1H

Annotation: Sulfotransferase (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 542 PF14559: TPR_19" amino acids 12 to 71 (60 residues), 36.7 bits, see alignment 2.4e-12 amino acids 81 to 140 (60 residues), 29.9 bits, see alignment 3.1e-10 PF13181: TPR_8" amino acids 41 to 68 (28 residues), 12.3 bits, see alignment (E = 9.5e-05) PF13432: TPR_16" amino acids 45 to 102 (58 residues), 36.5 bits, see alignment 2.9e-12 amino acids 107 to 171 (65 residues), 15.7 bits, see alignment E=9.2e-06 amino acids 161 to 203 (43 residues), 15.6 bits, see alignment 9.9e-06 PF13469: Sulfotransfer_3" amino acids 308 to 493 (186 residues), 151 bits, see alignment E=3.4e-47 PF00685: Sulfotransfer_1" amino acids 309 to 494 (186 residues), 39.2 bits, see alignment E=3e-13

Best Hits

KEGG orthology group: None (inferred from 100% identity to rru:Rru_A3684)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RN17 at UniProt or InterPro

Protein Sequence (542 amino acids)

>Rru_A3684 Sulfotransferase (NCBI) (Rhodospirillum rubrum S1H)
MQGHHAAARALRRQGRLGEAIARYRAALAATPGAAVLQAEMAECLFAAGQAEAAVKALGQ
AVRLDPDNATHRGNLAMLLARKGDLAGAIDHARAAVRLAPKDGALRLRLARLLIAAGHPR
EAEAEALDATRRLPREAASWIALAGARLLDQRPNDAEAPSARALALAPNDAEALSLRTDL
LLSLGRLAEAEATARLALKRQPTSLAALVALSKAKTFRPDDPDWPALAALLPSLGERSAE
EAVKLHFASAKALEDMGRDDEAFAHYQAGNSLKGRGLPDELPALSAMVDSLERWTPKLRP
VGEGDPLPVFIVGMPRSGTTLVEQILDRHRAIHGAGEILLFGERVVANGLGGYSADPQGL
DPERLAALGADYRDRLRGLAPRAGRIINKTPGNWLHLGLIAAALPGARIIWCRRDPVDCC
LSCFRNLFGQGHAWTTDLGRAGRYYRLQERLTGHWQAVLGDERMTAVDYEALVADPEAEA
RRLVAHLGLEWDEACLDHTRGGRAVTTLSQVQVRQPITDASVGRGRRFQTHLGPLLTALD
GR