Protein Info for Rru_A3682 in Rhodospirillum rubrum S1H

Annotation: Cytochrome B561 (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 188 transmembrane" amino acids 19 to 38 (20 residues), see Phobius details amino acids 50 to 70 (21 residues), see Phobius details amino acids 96 to 121 (26 residues), see Phobius details amino acids 146 to 169 (24 residues), see Phobius details PF01292: Ni_hydr_CYTB" amino acids 11 to 181 (171 residues), 117.1 bits, see alignment E=4.1e-38

Best Hits

KEGG orthology group: K12262, cytochrome b561 (inferred from 100% identity to rru:Rru_A3682)

Predicted SEED Role

"Cytochrome B561"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RN19 at UniProt or InterPro

Protein Sequence (188 amino acids)

>Rru_A3682 Cytochrome B561 (NCBI) (Rhodospirillum rubrum S1H)
MALPFGDEAARYGAVSRIAHWLTALAVIALIGLGWVMADLPLGAQKLELYALHKSIGALV
LMVTLARLGWRLAQRGPSGHAEHAPWERVMAKAAHVGLYAGLLAMPLTGWIASSAANFPV
SVFGLFTLPNLVAPDQALREAAATLHGALAWGVVGLIVLHAAGAVKHHLIDRDDTLRRML
PLARRPSR