Protein Info for Rru_A3680 in Rhodospirillum rubrum S1H

Annotation: Integral membrane protein TerC (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 330 transmembrane" amino acids 16 to 37 (22 residues), see Phobius details amino acids 49 to 69 (21 residues), see Phobius details amino acids 89 to 107 (19 residues), see Phobius details amino acids 114 to 136 (23 residues), see Phobius details amino acids 142 to 160 (19 residues), see Phobius details amino acids 207 to 229 (23 residues), see Phobius details amino acids 243 to 263 (21 residues), see Phobius details amino acids 271 to 291 (21 residues), see Phobius details amino acids 299 to 319 (21 residues), see Phobius details TIGR03718: integral membrane protein, TerC family" amino acids 15 to 321 (307 residues), 410.5 bits, see alignment E=2.4e-127 PF03741: TerC" amino acids 80 to 290 (211 residues), 182.2 bits, see alignment E=4.2e-58

Best Hits

Swiss-Prot: 48% identical to Y319_MYXXA: Uncharacterized membrane protein STKORF319 from Myxococcus xanthus

KEGG orthology group: K05794, tellurite resistance protein TerC (inferred from 100% identity to rru:Rru_A3680)

Predicted SEED Role

"Integral membrane protein TerC"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RN21 at UniProt or InterPro

Protein Sequence (330 amino acids)

>Rru_A3680 Integral membrane protein TerC (NCBI) (Rhodospirillum rubrum S1H)
MELLDFLFIPVMGKPAWAWLAFIAVVLVLLILDLGVLNRKSHDISIAQSLRLSVFYIAVA
LAYGGWVWWYLGETAGMDYLTGYVVEKSLSLDNIFVISLVFSYFAIPRAYQHRVLFWGIL
GVIVLRGIMIGLGAALISEFHWILYLFGAFLILTGVKMMVSRNEDDAASLADNKLIGFLR
RHLRVTEELDGERFWVRRPHPETGKSVAWATPLFLALVVVEATDVLFAVDSVPAVFAITT
DPFIVYTSNIFAILGLRALYFALAAMVHRFVYLHYALAAVLIFIGSKIFYAEFIGKMPAS
VSLGVTFALLALGVIVSLLRPADKTPDSRS