Protein Info for Rru_A3679 in Rhodospirillum rubrum S1H

Annotation: Rod shape-determining protein RodA (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 376 transmembrane" amino acids 26 to 47 (22 residues), see Phobius details amino acids 59 to 80 (22 residues), see Phobius details amino acids 85 to 105 (21 residues), see Phobius details amino acids 111 to 136 (26 residues), see Phobius details amino acids 148 to 167 (20 residues), see Phobius details amino acids 175 to 204 (30 residues), see Phobius details amino acids 282 to 303 (22 residues), see Phobius details amino acids 315 to 342 (28 residues), see Phobius details amino acids 348 to 370 (23 residues), see Phobius details TIGR02210: rod shape-determining protein RodA" amino acids 25 to 372 (348 residues), 390.1 bits, see alignment E=4.9e-121 PF01098: FTSW_RODA_SPOVE" amino acids 37 to 371 (335 residues), 303 bits, see alignment E=1.5e-94

Best Hits

KEGG orthology group: K05837, rod shape determining protein RodA (inferred from 100% identity to rru:Rru_A3679)

Predicted SEED Role

"Rod shape-determining protein RodA" in subsystem Bacterial Cytoskeleton or Peptidoglycan Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RN22 at UniProt or InterPro

Protein Sequence (376 amino acids)

>Rru_A3679 Rod shape-determining protein RodA (NCBI) (Rhodospirillum rubrum S1H)
MAKKELLDEPLVTPWHVVASLRIHDILFLLALAFLSLVGALALFSAAGGRADPWADSHLI
RFGIGLVAALALACVNVRLIMHAAYAIYGFFLLALVGVAVFGHVGMGAQRWLNLGVVAVQ
PSEFMKVGLIVALARYYHHLPNDRCTTLLAALPAAFLTLLPVGLVFLQPNLGTSILLAAT
GGIIALLGGLPLWTLVVAFTAAGVSLPVLWSHMHDYQKARVLTFLNPERDPLGAGYNIIQ
SKIALGSGGIWGKGLLNGSQSQLGFLPEKHTDFIFVVIAEELGMFGGMLILGACCAIVIY
GYIVAARTKYVFGRLCAVGVASSFFLYVFVNLAMVMGLIPVVGIPLPLVSYGGTVMIAVM
VSAGLLLNISIRPRLR