Protein Info for Rru_A3678 in Rhodospirillum rubrum S1H

Annotation: TRAP dicarboxylate transporter- DctP subunit (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 331 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details TIGR00787: TRAP transporter solute receptor, DctP family" amino acids 31 to 286 (256 residues), 331.4 bits, see alignment E=1.8e-103 PF03480: DctP" amino acids 31 to 313 (283 residues), 362.8 bits, see alignment E=6.7e-113

Best Hits

Swiss-Prot: 68% identical to DCTP_RHOCA: C4-dicarboxylate-binding periplasmic protein DctP (dctP) from Rhodobacter capsulatus

KEGG orthology group: K11688, C4-dicarboxylate-binding protein DctP (inferred from 100% identity to rru:Rru_A3678)

Predicted SEED Role

"TRAP-type C4-dicarboxylate transport system, periplasmic component"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RN23 at UniProt or InterPro

Protein Sequence (331 amino acids)

>Rru_A3678 TRAP dicarboxylate transporter- DctP subunit (NCBI) (Rhodospirillum rubrum S1H)
MKLSVFMGLILGGVMIAGGAQAADEPIVIKFSHVVAPDTPKGKAAEMFKKLAEEGTAGRV
KVEVYPNSQLYKDKEELEALQLGAVQMLAPSLAKFGPLGVKEFEVFDLPYIFPTKDVLRA
VTDGPIGASLLKKLEGRGIKGLAYWDNGFKIFSANKPLLKPDDLKGVKMRIQSSKVLDAE
MRALGALPQVMAFSEVYQALQTGVVDGTENPPSNMYTQKMHEVQKHATLTNHGYLGYAVI
VNKKFWEGLPADIRAPLETAMADSTKFANAIAQQENDDSLAAMKASGKTEFHMPSEDELK
AWQDALLPVHKEMEGRVGKDLIESIYAVSKQ