Protein Info for Rru_A3670 in Rhodospirillum rubrum S1H

Annotation: Potassium efflux system protein (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 576 transmembrane" amino acids 6 to 26 (21 residues), see Phobius details amino acids 33 to 51 (19 residues), see Phobius details amino acids 58 to 78 (21 residues), see Phobius details amino acids 87 to 108 (22 residues), see Phobius details amino acids 114 to 135 (22 residues), see Phobius details amino acids 150 to 175 (26 residues), see Phobius details amino acids 191 to 212 (22 residues), see Phobius details amino acids 233 to 263 (31 residues), see Phobius details amino acids 283 to 300 (18 residues), see Phobius details amino acids 309 to 333 (25 residues), see Phobius details amino acids 340 to 362 (23 residues), see Phobius details amino acids 374 to 393 (20 residues), see Phobius details PF00999: Na_H_Exchanger" amino acids 17 to 389 (373 residues), 170.1 bits, see alignment E=7.1e-54 PF02254: TrkA_N" amino acids 445 to 558 (114 residues), 77.3 bits, see alignment E=1.2e-25

Best Hits

KEGG orthology group: K03455, monovalent cation:H+ antiporter-2, CPA2 family (inferred from 100% identity to rru:Rru_A3670)

Predicted SEED Role

"Binding-protein-dependent transport systems inner membrane component:ATP/GTP-binding site motif A (P-loop) :TrkA-N:Potassium e" in subsystem Potassium homeostasis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RN31 at UniProt or InterPro

Protein Sequence (576 amino acids)

>Rru_A3670 Potassium efflux system protein (NCBI) (Rhodospirillum rubrum S1H)
MIHATPLITILVAGLGIAFIFGAIAHRLKVSPLVGYLLAGIVIGPATPGYVADQNLASEL
SEIGVILLMFGVGLHFSLKDLLSVRAIAVPGAIVQIAFATVLGIGIAHFAGWGLGGGIVF
GLALSVASTVVLLRAMQDRRLIDTLRGRIAVGWLIVEDLAMVMALVLLPAVAGALGVGTA
NGTPSLSLVDVGISLGVTLAKVAAFIVLMLVVGRRVIPWLLHRMASTGSRELFRLAVLVI
ALGVAFGSATLFGVSFALGAFFAGMVMNESELSGQAAQDTLPLRDAFAVLFFVSVGMLFN
PSSVIESPLLFVATLLVIVFGKSVAAFGLVLMFGHSKATALTIAASLAQIGEFSFILAPL
GVSLGLMPQQGQDLILAAAIVSILLNPFLFMLLDRYFLHDASASASAAADPPEPAPSSGA
ADDEDEAAIAVAKPAPVAPASGHAVVVGSGRVGALIGEMLAEREVRRVVIEESESVIEAL
RGKGVSCHLGNAADPETLALADTIEARWLFVAIPNAFEAGQVVEQARKSNPDLQIIARAH
SDAEVEHLKARGASRVVMAERETARGMIAEALLPRL