Protein Info for Rru_A3668 in Rhodospirillum rubrum S1H

Annotation: hypothetical protein (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 157 TIGR00011: Cys-tRNA(Pro) deacylase" amino acids 5 to 155 (151 residues), 173.5 bits, see alignment E=1.3e-55 PF04073: tRNA_edit" amino acids 32 to 144 (113 residues), 86.1 bits, see alignment E=1e-28

Best Hits

Swiss-Prot: 36% identical to YBAK_SALTY: Cys-tRNA(Pro)/Cys-tRNA(Cys) deacylase YbaK (ybaK) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: None (inferred from 100% identity to rru:Rru_A3668)

MetaCyc: 36% identical to Cys-tRNAPro/Cys-tRNACys deacylase YbaK (Escherichia coli K-12 substr. MG1655)
3.1.1.M26 [EC: 3.1.1.M26]

Predicted SEED Role

"Cys-tRNA(Pro) deacylase YbaK"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.1.M26

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RN33 at UniProt or InterPro

Protein Sequence (157 amino acids)

>Rru_A3668 hypothetical protein (NCBI) (Rhodospirillum rubrum S1H)
MSKTTRATQALDRAHVVHEVVSYEYDPDAPSIGLQAAQAIGEHPRRVLKTLMAEVDGKAV
CAVVPSDREVSMKKLAAVFGGKAAHMMKPADAERLTGFHVGGISPFGQKRTVPTVVEESA
LAEERVYMNGGQRGLQVRLAPADAVAALGARVASIVA