Protein Info for Rru_A3661 in Rhodospirillum rubrum S1H

Annotation: Major facilitator superfamily MFS_1 (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 426 transmembrane" amino acids 55 to 76 (22 residues), see Phobius details amino acids 87 to 105 (19 residues), see Phobius details amino acids 111 to 133 (23 residues), see Phobius details amino acids 152 to 173 (22 residues), see Phobius details amino acids 192 to 212 (21 residues), see Phobius details amino acids 251 to 272 (22 residues), see Phobius details amino acids 283 to 303 (21 residues), see Phobius details amino acids 313 to 330 (18 residues), see Phobius details amino acids 336 to 355 (20 residues), see Phobius details amino acids 371 to 391 (21 residues), see Phobius details amino acids 402 to 419 (18 residues), see Phobius details PF07690: MFS_1" amino acids 40 to 387 (348 residues), 80.1 bits, see alignment E=1.5e-26 PF11700: ATG22" amino acids 58 to 425 (368 residues), 137.6 bits, see alignment E=5.4e-44

Best Hits

KEGG orthology group: K06902, MFS transporter, UMF1 family (inferred from 100% identity to rru:Rru_A3661)

Predicted SEED Role

"transporter, putative"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RN40 at UniProt or InterPro

Protein Sequence (426 amino acids)

>Rru_A3661 Major facilitator superfamily MFS_1 (NCBI) (Rhodospirillum rubrum S1H)
MTGGAAAAPPGRGAAFSWCLFDFANSGYPTVVATFVFSAYVTKAVAATPEAGTAAWGYAM
GASGLLIALLAPIFGAVADHSGRRKPWLGLFSLLCVASTALMWTIRPDPAFLLAALVLAA
LSNAAFEIGGVFYNAMLPDVTTPERMGRLSGWAWGLGYAGGLACLVIALLALVQADPPPF
GLDKAAAEPVRATLVLVALWFVVFGWPLFAFVPERPTGRVLALGAAARGAIDSLKGLPAL
FRGDPRLGWFLLARMLYTEGLNTLFAFGGIYAAGTFDMGFDQIIVFGIGLNITAGLGAFA
FGWIDDWLGSPRTIVVGLIGLIGFCVAVLLVEDTAWFVGLALTMGIFFGPVQAASRTHIA
RVAPPDRRGELFGLFALTGKISAFAGPLAVGLATDLSGSQRLGMATVVVFLVAGLGLLVK
TRAPRG