Protein Info for Rru_A3650 in Rhodospirillum rubrum S1H

Annotation: Lipolytic enzyme, G-D-S-L (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 201 PF00657: Lipase_GDSL" amino acids 18 to 183 (166 residues), 67.7 bits, see alignment E=1.6e-22 PF13472: Lipase_GDSL_2" amino acids 18 to 178 (161 residues), 105.1 bits, see alignment E=6.7e-34

Best Hits

Swiss-Prot: 42% identical to ESTE_VIBMI: Arylesterase from Vibrio mimicus

KEGG orthology group: None (inferred from 100% identity to rru:Rru_A3650)

Predicted SEED Role

"Arylesterase precursor (EC 3.1.1.2)" (EC 3.1.1.2)

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.1.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RN51 at UniProt or InterPro

Protein Sequence (201 amino acids)

>Rru_A3650 Lipolytic enzyme, G-D-S-L (NCBI) (Rhodospirillum rubrum S1H)
MIPLAGPASAADPIVVSALGDSLTAGYNLPPETAFPVQLEAALRARGHDVRVINAGVSGD
TSAGGLARLDWMLGDHPQAVIVELGANDGLRGLDPARTRENLDSLLGRLKAEGLPVLLTG
MLAPPNLGRDYGAAFNGLFPDLAEKYDTLFYPFFLDGVARDPALTQPDGLHPTAEGVAVI
VARILPQAEALIARARKAASP