Protein Info for Rru_A3645 in Rhodospirillum rubrum S1H

Annotation: Silent information regulator protein Sir2 (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 243 signal peptide" amino acids 1 to 19 (19 residues), see Phobius details PF02146: SIR2" amino acids 14 to 187 (174 residues), 152.5 bits, see alignment E=6.3e-49

Best Hits

Swiss-Prot: 62% identical to NPD_PASMU: NAD-dependent protein deacylase (cobB) from Pasteurella multocida (strain Pm70)

KEGG orthology group: K12410, NAD-dependent deacetylase [EC: 3.5.1.-] (inferred from 100% identity to rru:Rru_A3645)

Predicted SEED Role

"NAD-dependent protein deacetylase of SIR2 family" in subsystem Pyruvate metabolism II: acetyl-CoA, acetogenesis from pyruvate or Redox-dependent regulation of nucleus processes

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.5.1.-

Use Curated BLAST to search for 3.5.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RN56 at UniProt or InterPro

Protein Sequence (243 amino acids)

>Rru_A3645 Silent information regulator protein Sir2 (NCBI) (Rhodospirillum rubrum S1H)
MTGLLPCPIVILTGAGVSKESGLDTFRDRDGVWARVRLEDVATPEGFARDPALVQAFYND
RRRGLLDPSCLPNPAHEALARLEREWPDEVLIVTQNIDDLHERAGSRQLIHMHGELTKAR
CLDCGAVLDWRADLGESDGCPACATVGTLRPHIVWFGEIPLEMERIQDALSTCGLFLSIG
TSGNVYPAAGFVRQARFEGAAHTVELNLEPSLGATLFEESLYGPASEVVPAYVERLLGAV
AGR