Protein Info for Rru_A3640 in Rhodospirillum rubrum S1H

Annotation: Ham1-like protein (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01725: Ham1p_like
  • amino acids 12 to 196 (185 residues), 210.2 bits, E=1.3e-66
• TIGR00042: non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
  • amino acids 12 to 195 (184 residues), 168.1 bits, E=7e-54

Best Hits

Swiss-Prot: 100% identical to IXTPA_RHORT: dITP/XTP pyrophosphatase (Rru_A3640) from Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1)

KEGG orthology group: K01516, nucleoside-triphosphatase [EC: 3.6.1.15] (inferred from 100% identity to rru:Rru_A3640)

Predicted SEED Role

"Nucleoside 5-triphosphatase RdgB (dHAPTP, dITP, XTP-specific) (EC 3.6.1.15)" in subsystem Heat shock dnaK gene cluster extended (EC 3.6.1.15)

MetaCyc Pathways

• superpathway of pyrimidine deoxyribonucleotides de novo biosynthesis (16/18 steps found)
• pyrimidine deoxyribonucleotides de novo biosynthesis III (9/9 steps found)
• pyrimidine deoxyribonucleotides de novo biosynthesis I (8/9 steps found)
• superpathway of pyrimidine deoxyribonucleotides de novo biosynthesis (E. coli) (11/14 steps found)
• UTP and CTP dephosphorylation I (5/7 steps found)
• pyrimidine deoxyribonucleotides de novo biosynthesis IV (5/7 steps found)
• pyrimidine deoxyribonucleotides biosynthesis from CTP (5/8 steps found)

KEGG Metabolic Maps

• Purine metabolism
• Thiamine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.6.1.15

Sequence Analysis Tools

See Q2RN61 at UniProt or InterPro

Protein Sequence (201 amino acids)

>Rru_A3640 Ham1-like protein (NCBI) (Rhodospirillum rubrum S1H)
MAMSRRLVESPLVVASHNAGKVREIAELIAPFGLEARSAASLDLPEPEETGSSFVENALL
KAHAAARATGLPALADDSGLAVSALGGDPGIYSARWAGPTKDFALAMATINHLLGDNPDR
SAHFVCALALAWPDGHAETFEGRVDGVLVWPPRGDQGFGYDPMFLGEGAAETFGEMDPAA
KHAISHRARAFALLVAACLGG