Protein Info for Rru_A3628 in Rhodospirillum rubrum S1H

Annotation: ParB-like partition protein (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 326 PF02195: ParB_N" amino acids 43 to 141 (99 residues), 108.9 bits, see alignment E=2.6e-35 TIGR00180: ParB/RepB/Spo0J family partition protein" amino acids 47 to 218 (172 residues), 200.3 bits, see alignment E=1.2e-63 PF17762: HTH_ParB" amino acids 144 to 240 (97 residues), 119.8 bits, see alignment E=1.1e-38 PF23552: ParB_C" amino acids 258 to 305 (48 residues), 56.9 bits, see alignment 2.3e-19

Best Hits

Swiss-Prot: 52% identical to PARB_CAUVN: Chromosome-partitioning protein ParB (parB) from Caulobacter vibrioides (strain NA1000 / CB15N)

KEGG orthology group: K03497, chromosome partitioning protein, ParB family (inferred from 100% identity to rru:Rru_A3628)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RN73 at UniProt or InterPro

Protein Sequence (326 amino acids)

>Rru_A3628 ParB-like partition protein (NCBI) (Rhodospirillum rubrum S1H)
MNGDTAAPGRRRGLGRGLSALLGDDPNDTVVQESAAAAAAAVASGRAIQVLPVGALVPNP
DQPRRHFDEEAIADLTESIRAKGILSPILARPDPNQPGTFQIIAGERRWRAAQRAQLHEV
PVLVRSFSDQETLEVALIENLQRQDLSPLEEAEGYRRLLEDFAHTQEDLAKVVGKSRSHV
ANTMRLLQLPDDVREMVEKGALSAGHARALLTTEAISDLARLVVSRGLNVRQTEKLVQQA
AAAANKPRRPATAAPTDKDADTLALERDISNVLGLAVEISAKARGGRLTIDYDSLSQLDD
ILHRLTRGHQGPLQRLAGEEPPLANG