Protein Info for Rru_A3618 in Rhodospirillum rubrum S1H

Annotation: hypothetical protein (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF03653: UPF0093
  • amino acids 10 to 148 (139 residues), 194.5 bits, E=5.7e-62
• TIGR00701: TIGR00701 family protein
  • amino acids 12 to 148 (137 residues), 154.9 bits, E=7.3e-50

Best Hits

Swiss-Prot: 47% identical to Y2845_RHOS4: UPF0093 membrane protein RHOS4_28450 (RHOS4_28450) from Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158)

KEGG orthology group: K08973, putative membrane protein (inferred from 100% identity to rru:Rru_A3618)

Predicted SEED Role

"Protoporphyrinogen IX oxidase, novel form, HemJ (EC 1.3.-.-)" (EC 1.3.-.-)

KEGG Metabolic Maps

• 1,1,1-Trichloro-2,2-bis(4-chlorophenyl)ethane (DDT) degradation
• Biosynthesis of alkaloids derived from shikimate pathway
• Limonene and pinene degradation

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.3.-.-

Sequence Analysis Tools

See Q2RN83 at UniProt or InterPro

Protein Sequence (148 amino acids)

>Rru_A3618 hypothetical protein (NCBI) (Rhodospirillum rubrum S1H)
MLSYGVEYTDPYAWVKTLHVIAVITWMAGLFYLPRLFVYHAMETPGSAASEKFKIMERRL
LRAIMNPSMIIVLVTGLLMIEGWLSSGWLHVKLLMVAGLITMHMFNARWRRDFEADRNTR
SHVFYRYANEIPTVMMLIIIPMVILKPF