Protein Info for Rru_A3589 in Rhodospirillum rubrum S1H

Annotation: Mg chelatase-related protein (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 506 TIGR00368: Mg chelatase-like protein" amino acids 5 to 496 (492 residues), 553.4 bits, see alignment E=2.3e-170 PF13541: ChlI" amino acids 20 to 140 (121 residues), 131.3 bits, see alignment E=5.2e-42 PF01078: Mg_chelatase" amino acids 188 to 390 (203 residues), 323.1 bits, see alignment E=1.9e-100 PF07728: AAA_5" amino acids 211 to 347 (137 residues), 37.2 bits, see alignment E=8.5e-13 PF00493: MCM" amino acids 285 to 350 (66 residues), 30 bits, see alignment E=8.5e-11 PF13335: Mg_chelatase_C" amino acids 400 to 496 (97 residues), 100.7 bits, see alignment E=1.7e-32

Best Hits

KEGG orthology group: K07391, magnesium chelatase family protein (inferred from 100% identity to rru:Rru_A3589)

Predicted SEED Role

"MG(2+) CHELATASE FAMILY PROTEIN / ComM-related protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RNB2 at UniProt or InterPro

Protein Sequence (506 amino acids)

>Rru_A3589 Mg chelatase-related protein (NCBI) (Rhodospirillum rubrum S1H)
MGARVHTVAFQGIDTLAIEVQVSITGGLPAFTVVGLPDKAVGESRERVRSALAAIGLSLP
PNRITVNLAPADVQKEGSHFDLPIALGLLLGMGILDPGDLDGYLVLGELGLDGSIAAVAG
VLPAALAAQASDRGLVCPAAQGGEAAWAASGDVLAPAGLLELVNHLKGTQILGRPRAEIA
SDPTVIADLSEVKGQETARRALEIAAAGAHNLLLVGPPGSGKSMLAQRLPGLLPPLTPAE
ALEVSMIHSVAGKLENGRLLRRRPFRDPHHTASAAAIAGGGLRARPGEISLAHNGVLFLD
ELPEFQRAALEALRQPLETGTIAVSRANLHVTYPARFQLVAAMNPCRCGHLDDPAQACSR
APRCAEEYQARISGPLFDRIDLHVEVPAVAPFDLARLRPGEATATVAARVAEARALQAER
YAGTKITTNREASGALLDRVATPDAPGQALLIEATGRLRLSARGYHRVLRVARTIADLEG
AAAITRTHIAEALSYRRRGPGRQSAV