Protein Info for Rru_A3585 in Rhodospirillum rubrum S1H

Annotation: Phosphatidylserine decarboxylase-related protein (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00164: phosphatidylserine decarboxylase homolog
  • amino acids 26 to 225 (200 residues), 165 bits, E=7.2e-53
• PF02666: PS_Dcarbxylase
  • amino acids 49 to 221 (173 residues), 141 bits, E=2e-45

Best Hits

Swiss-Prot: 100% identical to PSD_RHORT: Phosphatidylserine decarboxylase proenzyme (psd) from Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1)

KEGG orthology group: K01613, phosphatidylserine decarboxylase [EC: 4.1.1.65] (inferred from 100% identity to rru:Rru_A3585)

Predicted SEED Role

"Phosphatidylserine decarboxylase (EC 4.1.1.65)" in subsystem Glycerolipid and Glycerophospholipid Metabolism in Bacteria (EC 4.1.1.65)

MetaCyc Pathways

• superpathway of phospholipid biosynthesis III (E. coli) (10/12 steps found)
• phosphatidylserine and phosphatidylethanolamine biosynthesis I (2/2 steps found)
• cardiolipin and phosphatidylethanolamine biosynthesis (Xanthomonas) (2/4 steps found)
• superpathway of cardiolipin biosynthesis (bacteria) (8/13 steps found)
• superpathway of phospholipid biosynthesis II (plants) (10/28 steps found)

KEGG Metabolic Maps

• Glycerophospholipid metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.1.65

Sequence Analysis Tools

See Q2RNB6 at UniProt or InterPro

Protein Sequence (236 amino acids)

>Rru_A3585 Phosphatidylserine decarboxylase-related protein (NCBI) (Rhodospirillum rubrum S1H)
MRRFDIGWKTYLLPEIHPEGWRFISIFAAVTFGLWLWQDWLVVPGLVLTIWCVYFFRNPK
RTVPDRLGLVVTPASGIVQMVGLVDPPAELALDPPGPRQRISVFMSVFDCHVNRCPVGGT
VRKIVYAPGKFVNATLDKASADNERNSVVLDIGQSRDLAFVQIAGLVARRIRCDLVEGQS
VLTGEIMGLIRFGSRLDIYLPPGAAPLVAPGQSCISGETVLADLASAEPERLGVLR