Protein Info for Rru_A3584 in Rhodospirillum rubrum S1H

Annotation: CDP-diacylglycerol--serineO-phosphatidyltransferase (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 275 signal peptide" amino acids 1 to 42 (42 residues), see Phobius details transmembrane" amino acids 51 to 72 (22 residues), see Phobius details amino acids 84 to 103 (20 residues), see Phobius details amino acids 109 to 127 (19 residues), see Phobius details amino acids 143 to 167 (25 residues), see Phobius details amino acids 173 to 193 (21 residues), see Phobius details amino acids 205 to 224 (20 residues), see Phobius details amino acids 230 to 247 (18 residues), see Phobius details PF01066: CDP-OH_P_transf" amino acids 23 to 179 (157 residues), 86 bits, see alignment E=3.6e-28 TIGR00473: CDP-diacylglycerol-serine O-phosphatidyltransferase" amino acids 29 to 195 (167 residues), 116.5 bits, see alignment E=5.7e-38 PF08009: CDP-OH_P_tran_2" amino acids 209 to 244 (36 residues), 46 bits, see alignment 4.1e-16

Best Hits

Swiss-Prot: 38% identical to PSS_MYCLE: CDP-diacylglycerol--serine O-phosphatidyltransferase (pssA) from Mycobacterium leprae (strain TN)

KEGG orthology group: K00998, phosphatidylserine synthase [EC: 2.7.8.8] (inferred from 100% identity to rru:Rru_A3584)

Predicted SEED Role

"CDP-diacylglycerol--serine O-phosphatidyltransferase (EC 2.7.8.8)" in subsystem Glycerolipid and Glycerophospholipid Metabolism in Bacteria (EC 2.7.8.8)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.8.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RNB7 at UniProt or InterPro

Protein Sequence (275 amino acids)

>Rru_A3584 CDP-diacylglycerol--serineO-phosphatidyltransferase (NCBI) (Rhodospirillum rubrum S1H)
MVRHPHVLRRSTPRFQGMPFNKMVPNMLTLLALCAGLTSIRYGLHGEYQKAVVALVFSAI
FDGLDGRVARLLKGTSQFGAELDSLSDFVCFGVAPAMLLYLWTMSGAGGIGWALVLLYVV
CCGLRLARFNTQLMGEKDLPSWAYNYFTGVPAPAAAGLVLLPMILSFESGADFLVSPVVA
GVFLVGVAALMVSKLPTFSFKKAKIPHVYVLPLMLAIGVLAAFLVTNPWLTLGGLGLFYL
ALLPFGLRSFRKLQREAQQVTGEIAEETVGAPPEP