Protein Info for Rru_A3579 in Rhodospirillum rubrum S1H

Annotation: Peptidase M48, Ste24p (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 293 transmembrane" amino acids 7 to 24 (18 residues), see Phobius details amino acids 30 to 47 (18 residues), see Phobius details amino acids 142 to 163 (22 residues), see Phobius details amino acids 175 to 196 (22 residues), see Phobius details PF01435: Peptidase_M48" amino acids 66 to 277 (212 residues), 122.3 bits, see alignment E=1.1e-39

Best Hits

Swiss-Prot: 100% identical to HTPX_RHORT: Protease HtpX homolog (htpX) from Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1)

KEGG orthology group: K03799, heat shock protein HtpX [EC: 3.4.24.-] (inferred from 100% identity to rru:Rru_A3579)

Predicted SEED Role

"Probable protease htpX homolog (EC 3.4.24.-)" (EC 3.4.24.-)

Isozymes

Compare fitness of predicted isozymes for: 3.4.24.-

Use Curated BLAST to search for 3.4.24.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RNC2 at UniProt or InterPro

Protein Sequence (293 amino acids)

>Rru_A3579 Peptidase M48, Ste24p (NCBI) (Rhodospirillum rubrum S1H)
MSFFRVAVMLAAMTGLFLAVGYLIGGQSGMVIAFLVAGGMNLFAYWNSDKMVLRMHNARE
VDERSAPDLYGIVRQLTQRGGLPMPKVYVIDTPQPNAFATGRNPQNAAVAATTGLMRALT
PQELAGVMAHELAHVRHHDTLTMTLTATLAGAISMLANFAFFFGGNRDNNNPLGAVGMIV
MMILAPLAAMMVQMAISRTAEYRADRGGAEICGQPLWLASALEKIERAARGIENPSAEQN
PATAHLFIINPLNGHRMDNLFTTHPSTANRVAKLRALASGDLAQPRPQRGPWG