Protein Info for Rru_A3577 in Rhodospirillum rubrum S1H

Annotation: Protein of unknown function DUF6, transmembrane (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 284 transmembrane" amino acids 6 to 23 (18 residues), see Phobius details amino acids 30 to 51 (22 residues), see Phobius details amino acids 58 to 79 (22 residues), see Phobius details amino acids 90 to 108 (19 residues), see Phobius details amino acids 114 to 136 (23 residues), see Phobius details amino acids 148 to 165 (18 residues), see Phobius details amino acids 177 to 198 (22 residues), see Phobius details amino acids 210 to 231 (22 residues), see Phobius details amino acids 240 to 259 (20 residues), see Phobius details amino acids 266 to 283 (18 residues), see Phobius details PF00892: EamA" amino acids 7 to 131 (125 residues), 35.4 bits, see alignment E=6.2e-13

Best Hits

KEGG orthology group: None (inferred from 100% identity to rru:Rru_A3577)

Predicted SEED Role

"Integral membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RNC4 at UniProt or InterPro

Protein Sequence (284 amino acids)

>Rru_A3577 Protein of unknown function DUF6, transmembrane (NCBI) (Rhodospirillum rubrum S1H)
MDPLVFALVLGAAAMHAGWNAVVKVGLDGFSAVMLISMAAGVLSLLGLPFVPFPEPASWP
FLALSGCLHMGYNVALIGAYRAGDFGQIYPIARGAAPLMVAVLSALLLDEPPGLVAALGI
ALLVGGVWLMSIRGGAVGRSGGLPERRALLAALMTSCFIAAYTLSDGLGGRAAGSAHAYA
LWLFALDGVLALLVTVVLRGRAIFKGMARALPAGIGGGALSLGAYWTVIWAMSVAPLGQV
AALRESSVLFALLISVVFLGEKASRWRLGAAALIACGAGVIRLA