Protein Info for Rru_A3569 in Rhodospirillum rubrum S1H

Annotation: O-sialoglycoprotein endopeptidase (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 329 TIGR00329: metallohydrolase, glycoprotease/Kae1 family" amino acids 2 to 289 (288 residues), 285.2 bits, see alignment E=6.2e-89 TIGR03723: tRNA threonylcarbamoyl adenosine modification protein TsaD" amino acids 2 to 296 (295 residues), 371.1 bits, see alignment E=4.2e-115 PF00814: TsaD" amino acids 2 to 290 (289 residues), 300 bits, see alignment E=9.7e-94

Best Hits

Swiss-Prot: 100% identical to TSAD_RHORT: tRNA N6-adenosine threonylcarbamoyltransferase (tsaD) from Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1)

KEGG orthology group: K01409, O-sialoglycoprotein endopeptidase [EC: 3.4.24.57] (inferred from 100% identity to rru:Rru_A3569)

Predicted SEED Role

"TsaD/Kae1/Qri7 protein, required for threonylcarbamoyladenosine t(6)A37 formation in tRNA"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.4.24.57

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RND2 at UniProt or InterPro

Protein Sequence (329 amino acids)

>Rru_A3569 O-sialoglycoprotein endopeptidase (NCBI) (Rhodospirillum rubrum S1H)
MAEALLSQVEEHRPYGGVVPEIAARSHLDHVDSLVIRALGEAGLTVHDIDAVAATGGPGL
IGGVIVGVMTAKAIAQVAGKPFIAVNHLEGHALTVRMTAGIDFPYLLLLASGGHCQLLAV
EGVGRAKRLGTTIDDAAGEAFDKVAKMLGLGYPGGPAVERAARRGDPRRFRLPRPLLDRP
GCDLSFSGLKTAVRQTVEKLPPGPLSEGDIADLCASFQAAVADCLADRCRVAAGIFSARH
GRGRPLVVAGGVAANASLRAALTEVARQADMTFVAPPLALCTDNAAMIAWVGVERLRLGL
VDTMDFKPRPRWPLDPDAPKAAGAGGVKA