Protein Info for Rru_A3560 in Rhodospirillum rubrum S1H

Annotation: Putative diguanylate cyclase/phosphodiesterase (GGDEF & EAL domains) with PAS/PAC sensor(s) (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 850 900 951 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details PF13188: PAS_8" amino acids 15 to 65 (51 residues), 17 bits, see alignment 1.8e-06 amino acids 261 to 317 (57 residues), 23.5 bits, see alignment 1.6e-08 PF00989: PAS" amino acids 16 to 70 (55 residues), 27.4 bits, see alignment 1.2e-09 amino acids 264 to 374 (111 residues), 40.6 bits, see alignment E=9.6e-14 PF13426: PAS_9" amino acids 28 to 74 (47 residues), 17.6 bits, see alignment 1.6e-06 amino acids 270 to 376 (107 residues), 51.2 bits, see alignment E=5.4e-17 PF08447: PAS_3" amino acids 163 to 244 (82 residues), 31.7 bits, see alignment E=6e-11 amino acids 416 to 500 (85 residues), 38.9 bits, see alignment E=3.4e-13 TIGR00229: PAS domain S-box protein" amino acids 260 to 384 (125 residues), 78.3 bits, see alignment E=5.7e-26 amino acids 414 to 515 (102 residues), 29.7 bits, see alignment E=6.2e-11 PF08448: PAS_4" amino acids 266 to 379 (114 residues), 24.2 bits, see alignment E=1.3e-08 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 516 to 673 (158 residues), 95.5 bits, see alignment E=2.9e-31 PF00990: GGDEF" amino acids 519 to 673 (155 residues), 121 bits, see alignment E=1.7e-38 PF00563: EAL" amino acids 696 to 931 (236 residues), 242.8 bits, see alignment E=1.3e-75

Best Hits

KEGG orthology group: None (inferred from 100% identity to rru:Rru_A3560)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RNE1 at UniProt or InterPro

Protein Sequence (951 amino acids)

>Rru_A3560 Putative diguanylate cyclase/phosphodiesterase (GGDEF & EAL domains) with PAS/PAC sensor(s) (NCBI) (Rhodospirillum rubrum S1H)
MTSGVAPLPGIVSTLSAAAEAVSEALIALDADGGILVVNGAAERVFDRRRDDLIGRSLDV
VFGGDFAEAMASNLSAKVDALPPAPGGGRLLRRPGLPPLALHAGFSVTGDHGRPLATIVI
RDLSPRADSWLETEERLGGFAASMPGIIFQRVAHRDGSLSYPFLSSGVHAVLGYHPAEMS
VALDGCLNAIHWADRESYLRRLRQSAQTLAICSEEFRAITREGAVKWLSGASQPRAMANG
DILWDGVLVDVTERKRAELWLEMIMDRAADGIVTINEQGVIESANAAVGTFFGYADRGEL
IGRRVEILMAEADRRQHTRHMLRYRETGDGALIGAGPRELTGRRRDGTTFALELALSEVR
TEGRRIFIAVIRDITQRKETEGALAATRARLQTIADNVPGLVFQRELTAEGVLRFLFVSN
GVHEVLGITPEALLADGELFLGAMDPDVRAAFRETLRQSASRLEPMEEDIKLRGRDGEER
WLRGWSRPSRREDGSVVWDGVTLDVTDRKRAEDKLTFLAYYDPLTGLGNRSLFIDRFDRA
RRFAESIQAWVAVLSIGLDRFGMVNATIGHTMGDKVLIAVTRRLQQSLEAGSIVCRAGGD
RFLVLLTGLTDRADLREVVATIQDAFVPPIEVEGQQFDIGLTIGGALHPEDGREAETLIM
HADAALHRAKGGGGAFQMFTPEMGARAAHLLTIQHKLRRGLERHEFVAYFQPQVDLRSGL
ITGCEALARWNSPEDGLVPPGKFIGVAEEYGLIDAICGQVLDDSCRWLSTWRARGLPQVP
VAVNISGRQFQNARQLVAMVDQALRQSGVDPRLLELELTESSAMSDPENAIAVVNLLRER
GVSCAIDDFGTGYSSLSVLKRFPIGKLKIDRSFVMDVTTDPNDAAIVQAIIAMAHALNLR
VVAEGVETLDHLAFLREVHCDAVQGFLFARPLPGEDMALMLAGGPPQPNPR