Protein Info for Rru_A3548 in Rhodospirillum rubrum S1H

Annotation: Magnesium-protoporphyrin IX monomethyl ester anaerobic oxidative cyclase (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 535 TIGR02026: magnesium-protoporphyrin IX monomethyl ester anaerobic oxidative cyclase" amino acids 2 to 497 (496 residues), 802 bits, see alignment E=1.1e-245 PF02310: B12-binding" amino acids 14 to 129 (116 residues), 73.3 bits, see alignment E=1.6e-24 PF04055: Radical_SAM" amino acids 200 to 361 (162 residues), 89.6 bits, see alignment E=2.7e-29

Best Hits

Swiss-Prot: 75% identical to BCHE_RUBGE: Anaerobic magnesium-protoporphyrin IX monomethyl ester cyclase (bchE) from Rubrivivax gelatinosus

KEGG orthology group: K04034, anaerobic magnesium-protoporphyrin IX monomethyl ester cyclase [EC: 4.-.-.-] (inferred from 100% identity to rru:Rru_A3548)

MetaCyc: 67% identical to anaerobic magnesium-protoporphyrin IX monomethyl ester cyclase (Rhodobacter capsulatus)
RXN-13852 [EC: 1.21.98.3]

Predicted SEED Role

"Mg-protoporphyrin IX monomethyl ester oxidative cyclase (anaerobic) (EC 1.14.13.81)" in subsystem Chlorophyll Biosynthesis (EC 1.14.13.81)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.-.-.-

Use Curated BLAST to search for 1.14.13.81 or 1.21.98.3 or 4.-.-.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RNF3 at UniProt or InterPro

Protein Sequence (535 amino acids)

>Rru_A3548 Magnesium-protoporphyrin IX monomethyl ester anaerobic oxidative cyclase (NCBI) (Rhodospirillum rubrum S1H)
MRILFVHPNYHSGGAEVAGKWSPAWVAYLAGYLKAGGYSDIRFVDAMTDDMTEEELRAIF
AAEQPDVIGTTAVTPAIYKAERVLEIAREECPNAVTILGGIHATFMFQQVLVEAPWIDTV
VRGEGEAVTLNLIRAIDEGRWPADRASIKGIAYLEDTKVVATPAEPPIRDVDSIIPDWGV
LEWKKYIYIPLGVPVATPNMARGCPFTCSFCSQWKFWRDYRVRDPKKVVDEIEILVRQHG
VGFFILADEEPTINRNKFVEFCEELIRRDLGVMWGINTRVTDIMRDEDLLPLYRKAGLIH
ISLGTEAAAQLNLDIFHKETTVAQNKRAIELLRKHGIVTEAQFIVGLENETAETLEETYK
MCMDWNPDMANWSMFTPWPFSDLFHELGDKVEIFDFEKYNFVTPIMKPNAMDRAELLDRV
MHNYRRFYMRKSFLGYPWVLNRVRRRYLLGCLKAFLLSAFQRKFYDLGRAGYWGPQSKKK
VDFHFDHSRTLVKPQEDNWKNAPKHKRPAAAMKACGGGDEQLAESLTPPPVKVKI