Protein Info for Rru_A3544 in Rhodospirillum rubrum S1H

Annotation: Phosphate uptake regulator, PhoU (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 256 TIGR02135: phosphate transport system regulatory protein PhoU" amino acids 25 to 233 (209 residues), 199 bits, see alignment E=3.8e-63 PF01895: PhoU" amino acids 37 to 124 (88 residues), 72.6 bits, see alignment E=1.4e-24 amino acids 140 to 224 (85 residues), 81.9 bits, see alignment E=1.7e-27

Best Hits

Swiss-Prot: 45% identical to PHOU_CAUVC: Phosphate-specific transport system accessory protein PhoU homolog (phoU) from Caulobacter vibrioides (strain ATCC 19089 / CB15)

KEGG orthology group: K02039, phosphate transport system protein (inferred from 100% identity to rru:Rru_A3544)

Predicted SEED Role

"Phosphate transport system regulatory protein PhoU" in subsystem High affinity phosphate transporter and control of PHO regulon or Phosphate metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RNF7 at UniProt or InterPro

Protein Sequence (256 amino acids)

>Rru_A3544 Phosphate uptake regulator, PhoU (NCBI) (Rhodospirillum rubrum S1H)
MRKTRCHCPGSAPMTPTPDTHIVSSYDEELRKLDGRIQQMGGLAIAQTRDAIEVILGRHP
DVAARIFVREDEMNGLEHQVNEQVVRLLALRQPVADDLRTVITGLKVSGMLERVGDYAAN
AAKRGLTLQDAAPIPVRGPVSRMGDLVIAMLDDALKAFQTRDADLACQVRDRDAEVDELH
SSLFRELLTYMLEDPRSISACSQLMFVSKNLERVGDQATNVAEAAYYRSTGRILAGERPK
SDTTTQTTEASPGLPH