Protein Info for Rru_A3529 in Rhodospirillum rubrum S1H

Annotation: inner-membrane translocator (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 454 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details transmembrane" amino acids 156 to 176 (21 residues), see Phobius details amino acids 182 to 203 (22 residues), see Phobius details amino acids 209 to 229 (21 residues), see Phobius details amino acids 245 to 264 (20 residues), see Phobius details amino acids 298 to 317 (20 residues), see Phobius details amino acids 346 to 367 (22 residues), see Phobius details amino acids 373 to 393 (21 residues), see Phobius details amino acids 399 to 418 (20 residues), see Phobius details amino acids 424 to 445 (22 residues), see Phobius details PF02653: BPD_transp_2" amino acids 155 to 434 (280 residues), 84.8 bits, see alignment E=3e-28

Best Hits

KEGG orthology group: None (inferred from 100% identity to rru:Rru_A3529)

Predicted SEED Role

"High-affinity branched-chain amino acid transport system permease protein LivH (TC 3.A.1.4.1)" in subsystem ABC transporter branched-chain amino acid (TC 3.A.1.4.1) (TC 3.A.1.4.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RNH2 at UniProt or InterPro

Protein Sequence (454 amino acids)

>Rru_A3529 inner-membrane translocator (NCBI) (Rhodospirillum rubrum S1H)
MAWMRALAVLVSWLVVSLVGACAPIDSFQAGLCERALLALVPAEAPVAILDRASFSTADG
GAGLRLTYQLGSGESTGALTCLFAGQGLDANRLELRAVVDEGRGPLSAARLHMLKRFWLD
RPEAGAERTARLADGALAVVAEIPIDLAYFLQQTLNALPVIALYGLLAASYTLIYALGRT
ILLVFGELAMIGAMACFAGVALFSGLGGLGTAGVVGGAVVFALLASAVHGDALRRLVLQP
AAGRTPLALLVASFALAIVVQDYVRLSQDAGDRLLPTLPGRTHVLARAGEFVVAVTDFQL
VLVGGAGIVLGALVWGMGRGRFGRCWRAMAEDPQMATLCGVSKTRLWAICFALAATLAGL
AGVVVLLRFGLANAFMGAMLGFKALTAAVVGGIGRIQGAILGAVVIGGLETYWAAYFDMA
WRDVAVFALLAAALVLRPQGLVGLAERPDRVLRP