Protein Info for Rru_A3520 in Rhodospirillum rubrum S1H

Annotation: Protein of unknown function UPF0118 (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 434 transmembrane" amino acids 81 to 99 (19 residues), see Phobius details amino acids 105 to 124 (20 residues), see Phobius details amino acids 133 to 154 (22 residues), see Phobius details amino acids 223 to 246 (24 residues), see Phobius details amino acids 277 to 299 (23 residues), see Phobius details amino acids 311 to 336 (26 residues), see Phobius details amino acids 375 to 403 (29 residues), see Phobius details PF01594: AI-2E_transport" amino acids 86 to 409 (324 residues), 178.8 bits, see alignment E=8.4e-57

Best Hits

KEGG orthology group: None (inferred from 100% identity to rru:Rru_A3520)

Predicted SEED Role

"transport protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RNI1 at UniProt or InterPro

Protein Sequence (434 amino acids)

>Rru_A3520 Protein of unknown function UPF0118 (NCBI) (Rhodospirillum rubrum S1H)
MPGAEKGPQPRRPDFTEAGVIQNRAAGRNRSPDPSPDGAQARRRSWRNQGAWLSFVAWPH
RRGSATVEPPPLTLRQQLTTVRWLLTGLFAMMLLVFLYFGRDVLMPIVLALLLALMLSPI
VRLLRRRKVPEGVAAVVVTLGFAAGMLLIGFTISGPVATWLEDAPSIGKRIAHKLSSLRE
SFDVVLDASRQVEEAADTSSKDNTDRVVMAQPGLLVKAADSLASGFTTFGVTIVITLFFL
ASGSMFTEKIVHVMPLFRDKLRVLRVVRDIETEVSSYLLTVAMINAGLGVAVGCALWLAG
MPNAFLWGGMAMVLNFLPYIGSMIGISLVALVSFVTFDSLGQALIPPLSYLAVTSVEGQF
LTPAIVGRRLELNALSVMLAVLFWAWLWGIVGALIAVPLLVVVKVVCSHFEGLAVVGEFL
SARRPFSDQVKDGA