Protein Info for Rru_A3500 in Rhodospirillum rubrum S1H

Annotation: Cobalamin (vitamin B12) biosynthesis CbiM protein (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 211 signal peptide" amino acids 1 to 6 (6 residues), see Phobius details amino acids 26 to 26 (1 residues), see Phobius details transmembrane" amino acids 7 to 25 (19 residues), see Phobius details amino acids 37 to 56 (20 residues), see Phobius details amino acids 63 to 118 (56 residues), see Phobius details amino acids 130 to 154 (25 residues), see Phobius details amino acids 162 to 189 (28 residues), see Phobius details PF01891: CbiM" amino acids 2 to 196 (195 residues), 178.8 bits, see alignment E=6.2e-57

Best Hits

KEGG orthology group: K02007, cobalt/nickel transport system permease protein (inferred from 100% identity to rru:Rru_A3500)

Predicted SEED Role

"Substrate-specific component NikM of nickel ECF transporter" in subsystem ECF class transporters or Transport of Nickel and Cobalt

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RNK1 at UniProt or InterPro

Protein Sequence (211 amino acids)

>Rru_A3500 Cobalamin (vitamin B12) biosynthesis CbiM protein (NCBI) (Rhodospirillum rubrum S1H)
MHIAEGIVPLSVAAPLTVVAVAGVAKGLRAIDAERLPTCGLFSAVFFVASLIHVPLGPTS
THLVLSGLIGLMLGWAAFPAILVGLALQAVFFGFGGLLVLGVNTLTMAAPAVLAWALFRG
LADRLAPSRAPVLAAICGGLAVLVSALLVAGVLALSDQAFLPAAGLVVLGNLPVIGLESL
ITGAAVALLHRVRPEMLPRQGGRPWSGSFVS