Protein Info for Rru_A3473 in Rhodospirillum rubrum S1H

Annotation: DNA-directed DNA polymerase (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 659 TIGR02397: DNA polymerase III, subunit gamma and tau" amino acids 38 to 398 (361 residues), 406.1 bits, see alignment E=7.1e-126 PF13177: DNA_pol3_delta2" amino acids 55 to 217 (163 residues), 124.1 bits, see alignment E=2.2e-39 PF13401: AAA_22" amino acids 74 to 197 (124 residues), 29.9 bits, see alignment E=2.6e-10 PF00004: AAA" amino acids 77 to 212 (136 residues), 39.5 bits, see alignment E=3e-13 PF22608: DNAX_ATPase_lid" amino acids 224 to 270 (47 residues), 59.7 bits, see alignment 7.9e-20 PF12169: DNA_pol3_gamma3" amino acids 272 to 413 (142 residues), 185.8 bits, see alignment E=1.4e-58 PF12362: DUF3646" amino acids 501 to 609 (109 residues), 100.8 bits, see alignment E=2.3e-32

Best Hits

KEGG orthology group: K02343, DNA polymerase III subunit gamma/tau [EC: 2.7.7.7] (inferred from 100% identity to rru:Rru_A3473)

Predicted SEED Role

"DNA polymerase III subunits gamma and tau (EC 2.7.7.7)" in subsystem DNA-replication (EC 2.7.7.7)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.7.7

Use Curated BLAST to search for 2.7.7.7

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RNM8 at UniProt or InterPro

Protein Sequence (659 amino acids)

>Rru_A3473 DNA-directed DNA polymerase (NCBI) (Rhodospirillum rubrum S1H)
MRPVDPAPGMSDQVTPDSEAPSSEKPAGSKATPASAPYRVLARKYRPASFDALIGQEALV
RTLTNAIDSGRLAQAWMLTGVRGVGKTTTARLIARALNCVGADGKGGVTITPCGVCEHCK
AIAEDRHVDVLEMDAASRTGVGDIREILDGVRYRPAVARTKVYIIDEVHMLSTAAFNALL
KTLEEPPEHVKFIFATTEIRKVPVTVLSRCQRFDLRRVSAAELSGHFLRIAGLEGAEIAP
SALTLIARAADGSVRDGLSLLDQAIAHGGGTVSEAQVAEMLGLADRARIFDLLDALLAGR
IAESLDLLDRQYALGADPLVIVQDLLDLVHWMTRVKVVPVSAEDAAVPEAERTRGRAMAE
RLSMAVLNRCWQILLKGLGEARGAPVPLQAVEMVLIRLAYASDLPTPEEALKMIAGGAQP
AAPRPPAPHSPAGPPPAAPPPPSPPSRADEPPRPSRPSQSNAGGGALAVAPVEVAPDPPP
PPPPPPAPPAADPAGAFDPVPRSFALLVDLFRRKREAVVTGHLYRDVELVGYDPEAGLLE
IHPLPAAPAKLAGQITRLLGEWTGRRWMVTLTDRPGQPTLHDATQADIHAHPLVKAVLDR
FPGAVIGTIREHPGAVAAEADSPDLLGDPGEAYGAPGFDTPAGADPDDLFDPFIGDDET