Protein Info for Rru_A3466 in Rhodospirillum rubrum S1H

Annotation: Ornithine aminotransferase (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 415 TIGR01885: ornithine--oxo-acid transaminase" amino acids 22 to 414 (393 residues), 536.3 bits, see alignment E=2e-165 PF00202: Aminotran_3" amino acids 32 to 414 (383 residues), 415 bits, see alignment E=1.5e-128

Best Hits

Swiss-Prot: 75% identical to OAT_BRADU: Ornithine aminotransferase (rocD) from Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110)

KEGG orthology group: K00819, ornithine--oxo-acid transaminase [EC: 2.6.1.13] (inferred from 100% identity to rru:Rru_A3466)

Predicted SEED Role

No annotation

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.6.1.13

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RNN5 at UniProt or InterPro

Protein Sequence (415 amino acids)

>Rru_A3466 Ornithine aminotransferase (NCBI) (Rhodospirillum rubrum S1H)
MTSLAPPLAAGLASPTPEDLRDYLEVEHRLGAHNYKPLDVVLTRGQGVWVWDVAGRRYLD
CLSAYSAVNQGHCHPRILEALIAQAGRLTLTSRAFHNDQLAPFYEEICALTGSHKVLPMN
SGAEAVESALKCVRKWGYREKGVAEDQAEIIVCSDNFHGRTIAIVGFSSDPDARRDFGPF
APGFRCVPFGDGDALEAAITPRTVAVLIEPIQGEAGVIIPPPGYLKRVRDLCTAQGVMLI
LDEIQTGLGRTGALLAEEHEGIEADLTLVGKALSGGFYPVSAVLSNSEVLGVLRPGEHGS
TFGGNPLACAVARMALKVLVDEDMIGNAARQGAYFLEKLRGLGNPLIRAVRGRGLMLAVE
FAPEAGGARPFCEKLKDKGILCKETHRDIIRFAPPLVITEKEIDWAMERIAEVIG