Protein Info for Rru_A3454 in Rhodospirillum rubrum S1H

Annotation: Binding-protein-dependent transport systems inner membrane component (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 298 transmembrane" amino acids 12 to 35 (24 residues), see Phobius details amino acids 100 to 124 (25 residues), see Phobius details amino acids 136 to 162 (27 residues), see Phobius details amino acids 168 to 187 (20 residues), see Phobius details amino acids 217 to 238 (22 residues), see Phobius details amino acids 263 to 283 (21 residues), see Phobius details PF00528: BPD_transp_1" amino acids 112 to 293 (182 residues), 79.6 bits, see alignment E=1.3e-26

Best Hits

KEGG orthology group: K02050, sulfonate/nitrate/taurine transport system permease protein (inferred from 100% identity to rru:Rru_A3454)

Predicted SEED Role

"Pyrimidine ABC transporter, transmembrane component 1" in subsystem Pyrimidine utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RNP7 at UniProt or InterPro

Protein Sequence (298 amino acids)

>Rru_A3454 Binding-protein-dependent transport systems inner membrane component (NCBI) (Rhodospirillum rubrum S1H)
MATNAKGPAAWVGRAFPVLVVGAVLLCLWYAAALLLNQGLVDQAMVRSGQQWSIGQRLEA
AATHQRPILPTPVQVGAELWKSVVMTKPTSPRGLLLHTGVTGASTLVGFVLGTLLGLVIA
VGIVRFRVLEASLLPWVIASQTIPILAIAPMVVVVLGAIGLTGLVPKAIISMYLCFFPVT
VGMVKGLRSADALSMDLMRTYAARPSQVFWRLRLPAALPYLFASMKVAIAAALVGAIVGE
LPTGAAMGLGARLLAGSYYGQTVQMWAALVMAAALSLFLVFLVGRAEWLVRRLTGGFV