Protein Info for Rru_A3430 in Rhodospirillum rubrum S1H

Annotation: Acetyl-CoA carboxylase carboxyl transferase, beta subunit (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 374 TIGR00515: acetyl-CoA carboxylase, carboxyl transferase, beta subunit" amino acids 44 to 311 (268 residues), 376.5 bits, see alignment E=4.4e-117 PF17848: zf-ACC" amino acids 54 to 79 (26 residues), 37 bits, see alignment (E = 3.1e-13) PF01039: Carboxyl_trans" amino acids 121 to 361 (241 residues), 74.1 bits, see alignment E=9.5e-25

Best Hits

Swiss-Prot: 60% identical to ACCD_RHILO: Acetyl-coenzyme A carboxylase carboxyl transferase subunit beta (accD) from Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)

KEGG orthology group: K01963, acetyl-CoA carboxylase carboxyl transferase subunit beta [EC: 6.4.1.2] (inferred from 100% identity to rru:Rru_A3430)

Predicted SEED Role

"Acetyl-coenzyme A carboxyl transferase beta chain (EC 6.4.1.2)" in subsystem Fatty Acid Biosynthesis FASII (EC 6.4.1.2)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 6.4.1.2

Use Curated BLAST to search for 6.4.1.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RNS1 at UniProt or InterPro

Protein Sequence (374 amino acids)

>Rru_A3430 Acetyl-CoA carboxylase carboxyl transferase, beta subunit (NCBI) (Rhodospirillum rubrum S1H)
MGRGSGFPTPRRRDRPPPSRNGLESTRPMNWLTTYVRPKIRSLVGPREVPENLWRKCPAC
GHMIFHKELEKALQVCTHCGHHMRLPIKQRLELLFDDGAYTAIELPKPPLDPLRFKDIKR
YSDRLKEAQAKTGEKDAIIVGHGKLMGQGVVVAAFNFDFMGGSMGMAVGEGLVAAAELAL
LQKVPLIAIPSSGGARMQEGILSLMQMARSTVAVDRVKEAGLPYIVLLTDPTTGGVTASF
AMLGDIALAEPGAVIGFAGARVIETTIREKLPEGFQRSEYLLEHGMVDMVVPRSELKETL
ARLMALLMRRPPAAEVVTLSPDHRPAVVETPREAPKPKPRPPVEDLEAVARKVDDADFDG
ADAPPPPAPKPAKP