Protein Info for Rru_A3422 in Rhodospirillum rubrum S1H

Annotation: Two component Transcriptional regulator, Winged helix family (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 241 PF00072: Response_reg" amino acids 5 to 114 (110 residues), 99 bits, see alignment E=1.9e-32 PF00486: Trans_reg_C" amino acids 156 to 230 (75 residues), 80 bits, see alignment E=1.1e-26

Best Hits

Swiss-Prot: 66% identical to CHVI_SINFN: Transcriptional regulatory protein ChvI (chvI) from Sinorhizobium fredii (strain NBRC 101917 / NGR234)

KEGG orthology group: K14981, two-component system, OmpR family, response regulator ChvI (inferred from 100% identity to rru:Rru_A3422)

Predicted SEED Role

"DNA-binding response regulator ChvI"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RNS9 at UniProt or InterPro

Protein Sequence (241 amino acids)

>Rru_A3422 Two component Transcriptional regulator, Winged helix family (NCBI) (Rhodospirillum rubrum S1H)
MTHSIALVDDDRNILTSVSMTLEAEGFRVVTYTDGAEALRGLSIEPVDLAVLDIKMPRMD
GMELLQKLRERTAMPVIFLTSKDDEVDELLGLRMGADDYIKKPFSQRLLIERIRAILRRL
DLQKASPGGPELSAAALVRGDLTLDPDRHLCTWLERPVDLTVTEFLIIQALAQRPGHVKS
RDQLIDAAYGENIYVDDRTIDSHIKRLRKKFREVDREFSEIETLYGVGYRYRDPITVKAG
A