Protein Info for Rru_A3404 in Rhodospirillum rubrum S1H

Annotation: trkA-C domain protein (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 584 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details transmembrane" amino acids 30 to 49 (20 residues), see Phobius details amino acids 56 to 76 (21 residues), see Phobius details amino acids 93 to 123 (31 residues), see Phobius details amino acids 135 to 160 (26 residues), see Phobius details amino acids 172 to 194 (23 residues), see Phobius details amino acids 390 to 409 (20 residues), see Phobius details amino acids 415 to 433 (19 residues), see Phobius details amino acids 443 to 467 (25 residues), see Phobius details amino acids 482 to 512 (31 residues), see Phobius details amino acids 523 to 542 (20 residues), see Phobius details amino acids 562 to 582 (21 residues), see Phobius details PF03600: CitMHS" amino acids 17 to 531 (515 residues), 225.8 bits, see alignment E=1.2e-70 PF00939: Na_sulph_symp" amino acids 436 to 582 (147 residues), 27.7 bits, see alignment E=2.2e-10

Best Hits

KEGG orthology group: None (inferred from 100% identity to rru:Rru_A3404)

Predicted SEED Role

"Sulfate permease, Trk-type" in subsystem Cysteine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RNU7 at UniProt or InterPro

Protein Sequence (584 amino acids)

>Rru_A3404 trkA-C domain protein (NCBI) (Rhodospirillum rubrum S1H)
MSLDQLALLALMATTLVVLASDRLRYDVVAVGALLGAVGLGLVPIEHAFAGFASPVVVTV
AALLVIGRTLVALGLLEGLARRLADGGRTPLGLIVPLCGLGALAGACLSSFGALALMMPV
ALVAGTRRGIAASRLLLPLSFSTLLGGMTTLIGSPVNLLIAQARQDALGRPFALFDFAAA
GLPVAVAGLLWLGLASWRLLPERGPATTASGLPEGLEVGPYQTEGRVGGDSPLIGLRVPA
FERSRAVRVHGVIRGGLRVFARPADIDLRAGDVLLLEAALPVLQALAAREGIRPALPEAR
GGEEILEAVITPASIALGSCPLTLDAPGRWRVEIMAVARNGRRFEGGLGELSLMVGDLLL
LRGRPDHLQEALAALDCLPLRDRGIRLAGRGGAVPLVLFALALALAVLGLVPPPVAFVAA
LFGMVVSGALPLSEVYRRIDWPVVVFLAALIPIGDALAESGAAAGLAGGVLKLAGDIGPH
ALLAMTLAAAMGLSPLLGGVATTLMLAPVVLSLAAQASVSADPFLIAVAIGASADFFTPF
GHHNNALILGPGGYRFLDYGRAGLPLALIVLGVALAVIPQVWPF