Protein Info for Rru_A3391 in Rhodospirillum rubrum S1H

Annotation: Putative diguanylate cyclase (GGDEF domain) (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 360 transmembrane" amino acids 34 to 52 (19 residues), see Phobius details amino acids 58 to 80 (23 residues), see Phobius details amino acids 87 to 107 (21 residues), see Phobius details amino acids 113 to 129 (17 residues), see Phobius details amino acids 135 to 155 (21 residues), see Phobius details amino acids 161 to 183 (23 residues), see Phobius details PF20966: MASE6" amino acids 27 to 194 (168 residues), 59.3 bits, see alignment E=5e-20 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 194 to 358 (165 residues), 168.9 bits, see alignment E=3.9e-54 PF00990: GGDEF" amino acids 198 to 355 (158 residues), 153.2 bits, see alignment E=5.4e-49

Best Hits

KEGG orthology group: None (inferred from 100% identity to rru:Rru_A3391)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RNW0 at UniProt or InterPro

Protein Sequence (360 amino acids)

>Rru_A3391 Putative diguanylate cyclase (GGDEF domain) (NCBI) (Rhodospirillum rubrum S1H)
MSPPRLEDPITKSEAGVSPMLSPHEARDRHRHDVITRSLLVGALLCAIFAPFDFFLTGYW
VDATVEALGAATLLALGVFLRRGGDRLVAALIGHIIGGAVILTVVLGGKAQDAVFSWAVL
FPVLPFFVLGQRLGLLVSIVFATTATVGVTILAVLDGAQGFSWIAPFNLAGALAGCTVLA
YFYEGTRAKAARQLETLAKSDPLTGLANRRGLLDAFGGAVLTRSRAPHRLSLLVLDLDHF
KSINDRYGHEAGDGVLCHVAHVIKGMIRANDLIARIGGEEFALLLPDTDLAGAREVAEKI
RKAIESTALIGPGGSLSVTVSIGVAELDPQYPDFAALFSSADHRLYQAKKAGRNRVSAAT