Protein Info for Rru_A3390 in Rhodospirillum rubrum S1H

Annotation: hypothetical protein (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 471 PF04174: CP_ATPgrasp_1" amino acids 72 to 403 (332 residues), 512.7 bits, see alignment E=3.8e-158 PF14403: CP_ATPgrasp_2" amino acids 72 to 447 (376 residues), 559.8 bits, see alignment E=2.8e-172

Best Hits

Swiss-Prot: 55% identical to Y335_SYNY3: Uncharacterized protein sll0335 (sll0335) from Synechocystis sp. (strain PCC 6803 / Kazusa)

KEGG orthology group: None (inferred from 100% identity to rru:Rru_A3390)

Predicted SEED Role

"Protein containing domains DUF404, DUF407"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RNW1 at UniProt or InterPro

Protein Sequence (471 amino acids)

>Rru_A3390 hypothetical protein (NCBI) (Rhodospirillum rubrum S1H)
MPPRPFDEMTNPDGGIRSPYGLYSDWVNQTPLDVLRQKHAQADVLFRRIGITFAVYGDNQ
GGERLIPFDVVPRIISKKEWDILSRGVCQRVDALNRFIYDVYHDQEILKAGKVPKGLVRN
NGQFRKEMVGFTPPRNLYVQIAGIDIVRTAENEFHVLEDNLRTPSGVSYMLENRDVMTRL
FPELFNRHPVAPVNHYAQELLKTLQYSAPDHADNPTVVVLTPGQYNSAYFEHAFLADEMG
IELVQGQDLFVEGGHVYMRTIAGPQRVDVIYRRIDDDFLDPLAFRKDSMLGVPGLFEAYR
SGAVTLANAIGTGIADDKAIYDFVPGMIEFYLGEKPILRNVPTYHLDDDDDRAYVLEHLA
ELVVKEVHGSGGYGMLVGPRASRQQISDYRDRILADPANFIAQPTLALSTCPTFVDQGLA
PRHVDLRPFVLAGKTTQVVPGGLTRVALEKDSLVVNSSQGGGTKDTWVLER