Protein Info for Rru_A3386 in Rhodospirillum rubrum S1H

Annotation: BioY protein (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 182 transmembrane" amino acids 7 to 25 (19 residues), see Phobius details amino acids 31 to 50 (20 residues), see Phobius details amino acids 56 to 75 (20 residues), see Phobius details amino acids 86 to 107 (22 residues), see Phobius details amino acids 115 to 137 (23 residues), see Phobius details amino acids 144 to 172 (29 residues), see Phobius details PF02632: BioY" amino acids 32 to 174 (143 residues), 120.6 bits, see alignment E=2.5e-39

Best Hits

KEGG orthology group: K03523, putative biotin biosynthesis protein BioY (inferred from 100% identity to rru:Rru_A3386)

Predicted SEED Role

"Substrate-specific component BioY of biotin ECF transporter" in subsystem Biotin biosynthesis or ECF class transporters

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RNW5 at UniProt or InterPro

Protein Sequence (182 amino acids)

>Rru_A3386 BioY protein (NCBI) (Rhodospirillum rubrum S1H)
MTLTTRDLVLMGLFAAVMAALGLLPQFVLPLGVPVTAQSMGVMLAGAILGARRGFGAMAI
FVALVALGLPLLAGGRGGLGVFAGPSGGFVIGFPIAAWAVGLLVGLFRRPTSVPLTILAC
VLGGVGVLYAVGIPYWVAVTGNSLSAVLAIAVNFLPGDAIKAVVAGLVAVTVRRGYPALS
SR