Protein Info for Rru_A3359 in Rhodospirillum rubrum S1H

Annotation: Cobyrinic acid a,c-diamide synthase CbiA (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 460 TIGR00379: cobyrinic acid a,c-diamide synthase" amino acids 16 to 453 (438 residues), 324.1 bits, see alignment E=7.3e-101 PF01656: CbiA" amino acids 19 to 207 (189 residues), 52.9 bits, see alignment E=5.4e-18 PF07685: GATase_3" amino acids 263 to 454 (192 residues), 96.2 bits, see alignment E=3e-31

Best Hits

KEGG orthology group: K02224, cobyrinic acid a,c-diamide synthase [EC: 6.3.1.- 6.3.5.9] (inferred from 100% identity to rru:Rru_A3359)

Predicted SEED Role

"Cobyrinic acid A,C-diamide synthase" in subsystem Cobalamin synthesis or Coenzyme B12 biosynthesis

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.1.- or 6.3.5.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RNZ2 at UniProt or InterPro

Protein Sequence (460 amino acids)

>Rru_A3359 Cobyrinic acid a,c-diamide synthase CbiA (NCBI) (Rhodospirillum rubrum S1H)
MTLPFAAPPPIAPGLILSAPASGSGKTVLTLAILRALRQRGVAVAGIKTGPDYIDPAFHA
AASGRPCVNLDSWAMAPSLLRGLARAQGTGADLLLAEGVMGLFDGALGLPAGCDTADGST
AALARLLGWPVVLIVDVKGMATSVAALIAGFVRHRPDVAVRGVILNRVGSARHVAAMTAA
IASELPELCILGGLPRQGDLALPERHLGLVQAREHPDLERFLDASARLLTEHIDLDRLIA
LAQPLKNGPTDAAPRPLPPPGQRIALARDDAFAFTYPAVLQGWRDAGAEITFFSPLADEG
PDATADAIHLPGGYPELHAGRLAAGRTFLPSLRAAAGRGVAIFGECGGYMVLGRGLTAAD
GTLHAMAGLLPVDTSFAARRRHLGYRRARQLSAGWPGAVGEGFSAHEFHYASIIAEAGDE
AGRLFAVTDAGGTALGSVGQRRGSVAGSFLHLISAAPGPA