Protein Info for Rru_A3351 in Rhodospirillum rubrum S1H

Annotation: Methionyl-tRNA formyltransferase (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 309 signal peptide" amino acids 1 to 15 (15 residues), see Phobius details TIGR00460: methionyl-tRNA formyltransferase" amino acids 4 to 303 (300 residues), 291.8 bits, see alignment E=3e-91 PF00551: Formyl_trans_N" amino acids 5 to 178 (174 residues), 147.6 bits, see alignment E=3.4e-47 PF02911: Formyl_trans_C" amino acids 206 to 300 (95 residues), 75.7 bits, see alignment E=2.8e-25

Best Hits

Swiss-Prot: 60% identical to FMT_PARDP: Methionyl-tRNA formyltransferase (fmt) from Paracoccus denitrificans (strain Pd 1222)

KEGG orthology group: K00604, methionyl-tRNA formyltransferase [EC: 2.1.2.9] (inferred from 100% identity to rru:Rru_A3351)

MetaCyc: 52% identical to 10-formyltetrahydrofolate:L-methionyl-tRNAfMet N-formyltransferase (Escherichia coli K-12 substr. MG1655)
Methionyl-tRNA formyltransferase. [EC: 2.1.2.9]; 2.1.2.9 [EC: 2.1.2.9]

Predicted SEED Role

"Methionyl-tRNA formyltransferase (EC 2.1.2.9)" in subsystem Conserved gene cluster associated with Met-tRNA formyltransferase or Folate Biosynthesis (EC 2.1.2.9)

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.2.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RP00 at UniProt or InterPro

Protein Sequence (309 amino acids)

>Rru_A3351 Methionyl-tRNA formyltransferase (NCBI) (Rhodospirillum rubrum S1H)
MTLSVVFMGTPAFSVPILHALHNNPDLTLRAVYCQPPRAAGRGKKPRPTPVHAAAEALGI
PVFTPARLRDAADQQAFAELAADVAVVAAYGLILPKAVLDAPRLGCVNVHASLLPRWRGA
APIHRAIMAGDRETGVTLMQMDEGLDTGAMLRIGRVAITEQTTTASLHDTLSALGAEMIG
PALRDLAAGTLSGQAQPTEGVTYAAKIDKAEARLEWRTSAAVLDRQIRALSPFPGAWFER
DGERIKVLMSRVEEGVPAAPPGQLLDNQLTVACGEGAVRLLCLQRPGRGPLAADDFLRGY
AFPAGLSLT