Protein Info for Rru_A3345 in Rhodospirillum rubrum S1H

Annotation: Putative diguanylate cyclase/phosphodiesterase (GGDEF & EAL domains) with PAS/PAC sensor(s) (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 705 PF08447: PAS_3" amino acids 58 to 124 (67 residues), 45.7 bits, see alignment E=2e-15 amino acids 166 to 252 (87 residues), 37.5 bits, see alignment E=7.2e-13 PF13426: PAS_9" amino acids 77 to 128 (52 residues), 13.1 bits, see alignment 2.8e-05 amino acids 166 to 258 (93 residues), 20.9 bits, see alignment E=1.1e-07 TIGR00229: PAS domain S-box protein" amino acids 140 to 266 (127 residues), 34.6 bits, see alignment E=1.9e-12 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 268 to 422 (155 residues), 89.6 bits, see alignment E=1.8e-29 PF00990: GGDEF" amino acids 270 to 422 (153 residues), 115.3 bits, see alignment E=7.1e-37 PF00563: EAL" amino acids 448 to 681 (234 residues), 203.9 bits, see alignment E=7.5e-64

Best Hits

KEGG orthology group: None (inferred from 100% identity to rru:Rru_A3345)

Predicted SEED Role

"GGDEF family protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RP06 at UniProt or InterPro

Protein Sequence (705 amino acids)

>Rru_A3345 Putative diguanylate cyclase/phosphodiesterase (GGDEF & EAL domains) with PAS/PAC sensor(s) (NCBI) (Rhodospirillum rubrum S1H)
MTPPASSSPCSSSDKRNRAVPSAKALMVWRAGPDGRPLDPSQFPQDPPARRDGDGGGAEA
WLNLVHPEEREAVLLLWRRALREGEEFEARYRLHRGLSGYRWALGQGRPLRGDDGEVREW
IGTVVDIHDHMEAERTIALSEERLRLALDSADLGVWECTIATNQWWFSEAALRILGCPPD
AETSIETVMGAIHSDDLDGLRARWHAARTGRARDRMEGEFRIQRGGGRLGWIACSARLVA
DDGKAVTRMLGTLRDITKTRLQREKLYHLAHFDPLTGLPNRHEMITRTQATLASGGAAGG
AGAILLLDLDGFKEANDTLGQATGDALLKRIAHRLVSSLPADSLIGRVGGDEFLVVVPGV
AEQWTATRIADGLYDVLTVPFVIGDRRIPLSGRIGIALAPRDGTSAQDLMTHAELALQET
KTISGCVTRFFSPRLHDEARERQDMGLELRRATDNGEFELFYQPQIRLSDRAVVGAEALL
RWRHPTRGVMPPAAFLHVLKRGPLAGEVGEWVVAKACADAAGLLNAGSRIRMAVNLFSAQ
FKAGTVDATVRRSLLESGLPAELLELEITEKVTLDRDEGILTCLKGLRDLGCGVAFDDYG
TGYASLSMLKRYPLTRLKIDRAFVQHLAESPKDGAIVRAVLSLGNTFGLSVTAEGIEEEE
QEKLLLGQGCDEGQGYFFGRPMPLADFIQFLARVKKNPGEFPTPA