Protein Info for Rru_A3343 in Rhodospirillum rubrum S1H

Annotation: pyrimidine 5-nucleotidase (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 238 TIGR01993: pyrimidine 5'-nucleotidase" amino acids 14 to 192 (179 residues), 205.4 bits, see alignment E=6.4e-65 TIGR01509: HAD hydrolase, family IA, variant 3" amino acids 15 to 192 (178 residues), 56.1 bits, see alignment E=5e-19 PF00702: Hydrolase" amino acids 16 to 186 (171 residues), 68.5 bits, see alignment E=1.6e-22 PF13419: HAD_2" amino acids 16 to 192 (177 residues), 40.4 bits, see alignment E=5.5e-14 PF13242: Hydrolase_like" amino acids 148 to 203 (56 residues), 28.4 bits, see alignment E=1.9e-10

Best Hits

KEGG orthology group: K07025, putative hydrolase of the HAD superfamily (inferred from 100% identity to rru:Rru_A3343)

Predicted SEED Role

"Pyridoxal-5'-phosphate phosphatase (EC 3.1.3.74), Alphaproteobacterial type" (EC 3.1.3.74)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.3.74

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RP08 at UniProt or InterPro

Protein Sequence (238 amino acids)

>Rru_A3343 pyrimidine 5-nucleotidase (NCBI) (Rhodospirillum rubrum S1H)
MEDKMTRPAEGFETWLFDLDNTLYPASADLFAQIDLRMKAYIGRLLGLPPEEAFRLQKHY
YHTYGTSLRGLMDEHAIDPADFLAFVHDIDHTVLAADPVLGGLLARLPGRKIVFTNGSTR
HALAVLDRLGITDHFEAIHDIAASGFIPKPQPACYDDLIARYGLDPATTIMVEDSHKNLQ
PAAALGMTTLLVRNTLHWAAVEDGGAPMAYCHHVTDDLRIWLADWLAHQAPHPEVCLD