Protein Info for Rru_A3340 in Rhodospirillum rubrum S1H

Annotation: GTP-binding (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 231 TIGR03598: ribosome biogenesis GTP-binding protein YsxC" amino acids 36 to 225 (190 residues), 221.3 bits, see alignment E=4e-70 PF01926: MMR_HSR1" amino acids 54 to 177 (124 residues), 75.9 bits, see alignment E=6.9e-25 PF02421: FeoB_N" amino acids 54 to 113 (60 residues), 32.7 bits, see alignment E=1.3e-11

Best Hits

Swiss-Prot: 100% identical to ENGB_RHORT: Probable GTP-binding protein EngB (engB) from Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1)

KEGG orthology group: K03978, GTP-binding protein (inferred from 100% identity to rru:Rru_A3340)

Predicted SEED Role

"GTP-binding protein EngB" in subsystem Universal GTPases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RP11 at UniProt or InterPro

Protein Sequence (231 amino acids)

>Rru_A3340 GTP-binding (NCBI) (Rhodospirillum rubrum S1H)
MADLPETPAFGAAFSDEEEAARALEAGRWLFSQTCSFVMGCVSLDTLPDHDLSEIAFAGR
SNVGKSSLVNALTGRKTLARTSNTPGRTQELNYFRLGPEAQDPALMMVDLPGYGFAEAPK
DAVKRWTRLIMAYLRGRPALRRVCLLIDSRHGIKENDRDVMRMLDEAAVSYQIVLTKADK
LKAAEITDVLARVVAETAKHVAAHPDVIVTSSQSGAGIDLLRAQLAALASP