Protein Info for Rru_A3326 in Rhodospirillum rubrum S1H

Annotation: 4Fe-4S ferredoxin, iron-sulfur binding (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 506 transmembrane" amino acids 60 to 78 (19 residues), see Phobius details amino acids 112 to 134 (23 residues), see Phobius details amino acids 186 to 204 (19 residues), see Phobius details amino acids 217 to 240 (24 residues), see Phobius details amino acids 366 to 385 (20 residues), see Phobius details TIGR02745: cytochrome c oxidase accessory protein CcoG" amino acids 57 to 494 (438 residues), 472.4 bits, see alignment E=7.5e-146 PF12801: Fer4_5" amino acids 118 to 151 (34 residues), 28.8 bits, see alignment (E = 3.8e-10) PF13746: Fer4_18" amino acids 241 to 344 (104 residues), 126.9 bits, see alignment E=1.8e-40 PF12838: Fer4_7" amino acids 245 to 306 (62 residues), 27.7 bits, see alignment E=1.2e-09 PF11614: FixG_C" amino acids 380 to 505 (126 residues), 95.5 bits, see alignment E=1e-30

Best Hits

KEGG orthology group: None (inferred from 100% identity to rru:Rru_A3326)

Predicted SEED Role

"Type cbb3 cytochrome oxidase biogenesis protein CcoG, involved in Cu oxidation" in subsystem Biogenesis of cbb3-type cytochrome c oxidases or Terminal cytochrome C oxidases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RP25 at UniProt or InterPro

Protein Sequence (506 amino acids)

>Rru_A3326 4Fe-4S ferredoxin, iron-sulfur binding (NCBI) (Rhodospirillum rubrum S1H)
MRTIPRKAGVTMAVANEGPGSQAGQSRTAQAIKPIPGGNSLYESYQKVHPRRISGTYRSI
KWWMMGLLLTIFWVGPWLRWDRGPSVSDQAIFIDMPGRRAYFFFIEIWPQEVYYLTGLLI
IAAVGLFFATALLGRVWCGFACFQTVFTDLFVAVERLLEGDRNSRIKRDSSPMTVDTLMR
KTLKTVIWVLISLAVGIGFILYFYPAPWPAIVDIVTFNAGAAAYGTLAVVGGGCLIMAGY
AREQVCMYMCPYARFQSAMVDEDSMIVTYEKWRGEPRGKYSRDADFSQRGDCVDCGLCVQ
VCPTGVDIREGTQLGCIGCGLCVDACNSVMTRFGLPPNLIAYDSITNQNARAEGSSRRIR
LIRPRTLVYSALLLVVIGAMAASLATRSRLDISVLHERSPLFVTMSDGSVRNGYTFKVLN
MERIDNAFSLTTTGIAGATIEIVGVTKGPVTEANLPVAGDKVGTFRLYVSAPRASLPAPT
NDISFVLINSATGQTQTYKSLFAGPR