Protein Info for Rru_A3303 in Rhodospirillum rubrum S1H

Annotation: amide-urea binding protein (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 404 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details PF13433: Peripla_BP_5" amino acids 31 to 362 (332 residues), 57.6 bits, see alignment E=1.9e-19 PF13458: Peripla_BP_6" amino acids 31 to 368 (338 residues), 378.1 bits, see alignment E=9.3e-117 PF01094: ANF_receptor" amino acids 53 to 250 (198 residues), 27.2 bits, see alignment E=3.2e-10

Best Hits

KEGG orthology group: K01999, branched-chain amino acid transport system substrate-binding protein (inferred from 100% identity to rru:Rru_A3303)

Predicted SEED Role

"Leucine-, isoleucine-, valine-, threonine-, and alanine-binding protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RP47 at UniProt or InterPro

Protein Sequence (404 amino acids)

>Rru_A3303 amide-urea binding protein (NCBI) (Rhodospirillum rubrum S1H)
MTFTPRRALISALLLGLAPYAQAAEISDKVIRIGVLNDQSGVYADIAGTGSVEAARMAAE
EFGGEIDGAKIEFVSADHQNKADIAANVANQWIDTGGVDAIVDIPNSSAMLAVQEIGRTK
KRIVIASGGGSTDFTGPKCSPYGFHWTYDTYSLAKGTAESLVKDGGTTWYNIVVDYAFGH
SLDTDTSRFITQAGGQVVGRVLHPLGTSDFSSYLLQAQGSGAKVIGVLSAGADTVNAIKQ
AAEFGITQGGQILAGLLIFDQTVHSLGLETAQGLRLTTGFYWDRTDATRAWSAEFLKRST
KNIPSMAHAGVYSGVRHYLAAIKAAGTDNADAVAAKMRETPVNDMFAENGTVRADGRMVH
DMYLMEVKKPADSTSEWDLMRLVHVIPGEEAYRPLAEGGCPLVQ