Protein Info for Rru_A3300 in Rhodospirillum rubrum S1H

Annotation: ABC transporter component (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 629 transmembrane" amino acids 42 to 63 (22 residues), see Phobius details amino acids 83 to 105 (23 residues), see Phobius details amino acids 163 to 184 (22 residues), see Phobius details amino acids 197 to 219 (23 residues), see Phobius details amino acids 280 to 305 (26 residues), see Phobius details amino acids 311 to 330 (20 residues), see Phobius details PF06472: ABC_membrane_2" amino acids 49 to 294 (246 residues), 119.6 bits, see alignment E=2.5e-38 PF05992: SbmA_BacA" amino acids 62 to 359 (298 residues), 66.6 bits, see alignment E=4.1e-22 PF00005: ABC_tran" amino acids 404 to 542 (139 residues), 49.6 bits, see alignment E=9.8e-17

Best Hits

KEGG orthology group: K02471, putative ATP-binding cassette transporter (inferred from 100% identity to rru:Rru_A3300)

Predicted SEED Role

"ABC TRANSPORTER ATP-BINDING PROTEIN"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RP50 at UniProt or InterPro

Protein Sequence (629 amino acids)

>Rru_A3300 ABC transporter component (NCBI) (Rhodospirillum rubrum S1H)
MAIPDPSPRPSPEPVKADTDALWPQVRSMARAFWKSPARNRLIFLGGGLATVIALTAFGQ
MWLNAWNQPFYDSLARKDMDGFIHQLWVFAGIAFLLLTLNVSQTWLNQSTKVKLREGLVR
DLLDDWLQGRRAFRLAFNSEIGVNPDQRIHEDARHLSELTTDLGIGLLQASLLLATFIGV
LWGLSRGIVLHIDGQVLAIPGYMVWCALLYAGIASLLSWKVGSPLVRLNALRYAREADLR
FNLVRVSEHMEGIALHGGEADERDRLSSDLDRVLGIMRRIVGAVTGLTWITAGYGWFTLV
APILVAAPGYFHGNLSFGELMMAVGAFIQVQQALRWFIDNVSAIADWRATLLRVSSFREG
LQAMDRLGEGRGRIDFAPSTDRQVILSGLEVASPAGAISLSQPEVVIEPGQHLLIIGDSG
TGKTVFFRAIAGLWPWGKGRIGLPPDDDLQDREGDGVMFLPRHPYIPPGTLRAAISYPQA
ADDFDDWALVEALGSMGLAHLAARLNRSARWDKELTDDERRCLAFARVALRKPKVVIMDE
AFDVLDDASLGRAMAIFREKLRKTIVITIGRPEVRDHFFDQVLRLSLDPAGPRFLPDDHA
TGDADRDAPTAGDDEEGLSVRAVPKESSL