Protein Info for Rru_A3297 in Rhodospirillum rubrum S1H

Annotation: hypothetical protein (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 251 transmembrane" amino acids 22 to 45 (24 residues), see Phobius details amino acids 54 to 75 (22 residues), see Phobius details amino acids 86 to 111 (26 residues), see Phobius details amino acids 117 to 137 (21 residues), see Phobius details amino acids 149 to 169 (21 residues), see Phobius details amino acids 175 to 198 (24 residues), see Phobius details amino acids 206 to 236 (31 residues), see Phobius details PF03591: AzlC" amino acids 33 to 173 (141 residues), 53.5 bits, see alignment E=1.8e-18

Best Hits

KEGG orthology group: None (inferred from 100% identity to rru:Rru_A3297)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RP53 at UniProt or InterPro

Protein Sequence (251 amino acids)

>Rru_A3297 hypothetical protein (NCBI) (Rhodospirillum rubrum S1H)
MTLAPPPMPPSDAPAAESAGATLRLVIADALVVILTFIVMFLGVGQLSAEAGLSAVQTAV
MTLLTVAAPAQAAAMQIMTSDGATSGVWVAAMVAVIIVNLRFMVMVASILGRLPQAGFLR
GTAAVGLVSASSFAIILPRLMSAPPARPLLYCALVGVSCSISAVIGALLGHQLAASVPAL
VGAALGAMIPIYFATLIARQGKHKALIANALAGAVLVPLAAPLLGSLSLLIVPLGISALS
LMIGKGTPANG