Protein Info for Rru_A3276 in Rhodospirillum rubrum S1H

Annotation: Ornithine carbamoyltransferase (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02729: OTCace_N
  • amino acids 8 to 148 (141 residues), 166.3 bits, E=5e-53
• TIGR00658: ornithine carbamoyltransferase
  • amino acids 8 to 305 (298 residues), 384.1 bits, E=2.2e-119
• PF00185: OTCace
  • amino acids 155 to 304 (150 residues), 173 bits, E=5.2e-55

Best Hits

Swiss-Prot: 63% identical to OTC_AGRFC: Ornithine carbamoyltransferase (argF) from Agrobacterium fabrum (strain C58 / ATCC 33970)

KEGG orthology group: None (inferred from 100% identity to rru:Rru_A3276)

MetaCyc: 45% identical to L-ornithine carbamoyltransferase (Sulfolobus acidocaldarius)
Ornithine carbamoyltransferase. [EC: 2.1.3.3]

Predicted SEED Role

"Ornithine carbamoyltransferase (EC 2.1.3.3)" in subsystem Arginine Biosynthesis extended or Arginine Deiminase Pathway or Arginine and Ornithine Degradation (EC 2.1.3.3)

MetaCyc Pathways

• L-arginine biosynthesis II (acetyl cycle) (10/10 steps found)
• superpathway of arginine and polyamine biosynthesis (14/17 steps found)
• L-arginine biosynthesis I (via L-ornithine) (8/9 steps found)
• L-citrulline degradation (3/3 steps found)
• L-arginine degradation XIII (reductive Stickland reaction) (4/5 steps found)
• L-citrulline biosynthesis (6/8 steps found)
• L-arginine degradation V (arginine deiminase pathway) (3/4 steps found)
• urea cycle (3/5 steps found)
• superpathway of L-citrulline metabolism (8/12 steps found)
• L-arginine biosynthesis IV (archaea) (4/9 steps found)
• L-arginine degradation XIV (oxidative Stickland reaction) (1/6 steps found)

KEGG Metabolic Maps

• Arginine and proline metabolism
• Urea cycle and metabolism of amino groups

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.3.3

Sequence Analysis Tools

See Q2RP74 at UniProt or InterPro

Protein Sequence (308 amino acids)

>Rru_A3276 Ornithine carbamoyltransferase (NCBI) (Rhodospirillum rubrum S1H)
MTVMKTPRHFLELSDFDAPALRAMLDRGLAFKAERRAGVVSAPLAGKTLALIFEKPSTRT
RVSFEVGMRQLGGSSITLSPTETQLGRGETIADTARVLSRYVDGIMLRTNDPAKLRDLSQ
NASVPVINGLTDAAHPCQIMADLMTFEEHRGSITGKVVTWVGDGNNVACSWIKASALFGF
TMRLACPAELEPPQGVLDWARANGGAVEVLRDPQEAVAGADCVVTDTWVSMGCDGAAARH
ALLRPYQVTAPLMAAAAADALFMHCLPAHRGEEVTEDVIDGPQSVVWDEAENRLHAQKGI
LAWCMAGS