Protein Info for Rru_A3267 in Rhodospirillum rubrum S1H

Annotation: Methionine biosynthesis MetW (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF07021: MetW
  • amino acids 11 to 205 (195 residues), 265.8 bits, E=5.1e-83
• TIGR02081: methionine biosynthesis protein MetW
  • amino acids 11 to 205 (195 residues), 251.6 bits, E=2.2e-79
• PF13847: Methyltransf_31
  • amino acids 23 to 111 (89 residues), 31.4 bits, E=3.8e-11
• PF13489: Methyltransf_23
  • amino acids 23 to 173 (151 residues), 37.9 bits, E=3.7e-13
• PF13649: Methyltransf_25
  • amino acids 27 to 110 (84 residues), 32.5 bits, E=2.8e-11
• PF08241: Methyltransf_11
  • amino acids 28 to 111 (84 residues), 36.1 bits, E=2.2e-12

Best Hits

KEGG orthology group: None (inferred from 100% identity to rru:Rru_A3267)

Predicted SEED Role

"Homoserine O-acetyltransferase (EC 2.3.1.31)" in subsystem Methionine Biosynthesis (EC 2.3.1.31)

MetaCyc Pathways

• superpathway of L-methionine biosynthesis (by sulfhydrylation) (12/12 steps found)
• superpathway of sulfur amino acid biosynthesis (Saccharomyces cerevisiae) (9/10 steps found)
• L-methionine biosynthesis III (4/4 steps found)
• superpathway of L-cysteine biosynthesis (fungi) (5/6 steps found)
• L-homocysteine biosynthesis (2/2 steps found)

KEGG Metabolic Maps

• Methionine metabolism
• Sulfur metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.31

Use Curated BLAST to search for 2.3.1.31

Sequence Analysis Tools

See Q2RP83 at UniProt or InterPro

Protein Sequence (211 amino acids)

>Rru_A3267 Methionine biosynthesis MetW (NCBI) (Rhodospirillum rubrum S1H)
MTPTGPTGAIRYDLQLIADMVTPGARVLDVGCGEGDLLSYLRTFKQVDGRGIELSMAGVR
AAVSQGVPVIQGDADTDLSDYPDGAFDYAILSQTLQATERPRDVLINMLRIADRAIVSFP
NFAHWRGRLHLLVRGRMPVSEYLPYEWWETPNIHFCTIRDFLKLCRELDLTVERALALDE
RGRPERFPANCPIANFMSAQAVFLLARGSRR