Protein Info for Rru_A3255 in Rhodospirillum rubrum S1H

Annotation: Protein of unknown function DUF214 (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 298 transmembrane" amino acids 20 to 40 (21 residues), see Phobius details amino acids 168 to 189 (22 residues), see Phobius details amino acids 225 to 248 (24 residues), see Phobius details amino acids 266 to 290 (25 residues), see Phobius details PF02687: FtsX" amino acids 175 to 291 (117 residues), 27.2 bits, see alignment E=1.8e-10

Best Hits

KEGG orthology group: K09811, cell division transport system permease protein (inferred from 100% identity to rru:Rru_A3255)

Predicted SEED Role

"Cell division protein FtsX" in subsystem Bacterial Cell Division

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RP95 at UniProt or InterPro

Protein Sequence (298 amino acids)

>Rru_A3255 Protein of unknown function DUF214 (NCBI) (Rhodospirillum rubrum S1H)
MRFPRTDLPIAEDGSGRFLAIMVAVMVFLATLAMAGAMAVQTVVDRWNRDVSGTLTVQVM
PAEGSPEESGKTTEEWVEQALVVLRADRAVADAQAIPIERLKALMEPWLGAADLVDDLPM
PRLIDVTLKPDTPFDLAALGRRLSEAVPGATLDDHRLWLAKLVNLAEALASLSLAVLVLV
TAATSLAVVQATRTAMTTHRPAIEVLHMIGAHDAYIARQFAARSLVLGLMGGGTGLILAL
PAILGIGYLCRDIEGGFVPDVGLGAVHWLILVCLPLAGGLVAMLTTRVTVLRTLARML