Protein Info for Rru_A3247 in Rhodospirillum rubrum S1H

Annotation: hypothetical protein (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 123 transmembrane" amino acids 47 to 67 (21 residues), see Phobius details amino acids 73 to 94 (22 residues), see Phobius details PF09527: ATPase_gene1" amino acids 44 to 95 (52 residues), 59.6 bits, see alignment E=1.2e-20

Best Hits

Swiss-Prot: 100% identical to ATPZ_RHORU: ATP synthase protein I (atpI) from Rhodospirillum rubrum

KEGG orthology group: K02116, ATP synthase protein I (inferred from 100% identity to rru:Rru_A3247)

Predicted SEED Role

"ATP synthase protein I" in subsystem F0F1-type ATP synthase

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RPA3 at UniProt or InterPro

Protein Sequence (123 amino acids)

>Rru_A3247 hypothetical protein (NCBI) (Rhodospirillum rubrum S1H)
MTDRDTPPSLEDISRRLTEAKGGADGAEADGAGSSGPARASGLGIGMRISIELVTTIAVG
GAIGYGLDSWLGTSPLAMVVFLVLGGAAGVMNAYRVVKGLDDSVGLGRAIERKEKAEGNK
DRA