Protein Info for Rru_A3235 in Rhodospirillum rubrum S1H

Annotation: Secretion protein HlyD (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 391 signal peptide" amino acids 1 to 34 (34 residues), see Phobius details TIGR01730: efflux transporter, RND family, MFP subunit" amino acids 51 to 373 (323 residues), 166.1 bits, see alignment E=5.1e-53 PF25917: BSH_RND" amino acids 73 to 223 (151 residues), 58.2 bits, see alignment E=1.8e-19 PF25876: HH_MFP_RND" amino acids 119 to 195 (77 residues), 29.9 bits, see alignment E=1.7e-10 PF25944: Beta-barrel_RND" amino acids 233 to 308 (76 residues), 27.3 bits, see alignment E=1.2e-09 PF25954: Beta-barrel_RND_2" amino acids 236 to 309 (74 residues), 24.7 bits, see alignment E=6.6e-09 PF25967: RND-MFP_C" amino acids 316 to 374 (59 residues), 26 bits, see alignment E=2.1e-09

Best Hits

Swiss-Prot: 40% identical to MACA_YERPE: Macrolide export protein MacA (macA) from Yersinia pestis

KEGG orthology group: K13888, macrolide-specific efflux protein MacA (inferred from 100% identity to rru:Rru_A3235)

Predicted SEED Role

"Macrolide-specific efflux protein MacA" in subsystem Multidrug Resistance Efflux Pumps

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RPB5 at UniProt or InterPro

Protein Sequence (391 amino acids)

>Rru_A3235 Secretion protein HlyD (NCBI) (Rhodospirillum rubrum S1H)
MPPPPASRPRRPSRRTLVLILGLLAACALGAWALGWFGANGDKAPPPRQQTVELGSVENA
ITAVGSLQPKTYVDVGAQVSGKVSHLPVVIGDRVEKGDLLTVIDPRTYEARVRTDKAALA
KLHADRRKAEAQLGLSRQQRARTERLFQAKATSQDSLDSARTTVLVDQAAIESIDAQIEQ
ALAELDADQADLDYTQVYATMSGTIVSIAVVEGQTLNSVQSAPDLMRIADLDTMTVKAEV
AEADITAIKPGMPGYFTTLGGGGRRWQGTVRLIEPTPVTDNDVVLYNVLMDVANPDGALM
TDMTAQVFFLKDRAENVPVVPLAALTPTATAGTWTASVQGPGGLEQRTVTTGVVNRALAQ
VVDGLAVGDKVVLPRATPGATAGGFKPPPML